KEGG   Staphylococcus epidermidis ATCC 12228: SE1068Help
Entry
SE1068            CDS       T00110                                 

Definition
phosphate ABC transporter
Orthology
K02038  
phosphate transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Phosphate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1079573..1080478)
Genome map
AA seq 301 aa AA seqDB search
MSTHSNTANKTLIDKDAVEKNISSRDRKNSVNKWLFLLCTLIGLIVLVALLIQTFVKGAG
HLTPEFFTNFSSSTPADAGIKGALVGSIWLILSIIPISIILGIGTAIYLEEYARDNIFTQ
IVKVSISNLAGVPSIVFGLLGYTLFVGAAGLGNSVLAAALTMSLLILPVIIVASQEAIRA
VPSSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVMIGIPTILL
ATPSGLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNTVAILLRNKFSKK
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacattcaaatactgctaacaaaacattgattgataaagatgccgtagaaaaa
aatatttcttctcgtgataggaaaaactcggtaaacaaatggttatttttattatgtaca
ttaattgggctcattgttttagtagcactattaattcaaactttcgttaaaggggcggga
catctaactcccgaatttttcactaatttttcatcttcaacaccagcagatgctggtatt
aaaggggctttagtaggttctatttggttaatcttaagtattatcccaattagtatcatt
ttaggaataggtacagcaatttatttagaagaatacgcaagagacaatatttttacacaa
atcgtaaaggtgagtatatctaatttagctggtgttccttcaattgttttcggtttacta
ggttatacattatttgtaggcgcggcaggtttaggtaatagcgtgctagccgctgcgctt
acaatgtcactactaatcttgcctgttattatcgttgctagtcaggaagctatcagagca
gttcctagttcagtcagagaagcatcatatggtcttggtgctaataaatggcaaacaatt
agaagagttgttttacctgcagcattacctggtattttaacaggtttcattttatcttta
tcacgcgcattaggagaaacagcaccacttgtaatgataggtatacctacgatactttta
gcaacaccaagtggattactcgaccaattctctgcgttaccaactcaaatttatacatgg
gcaaaaatgcctcaagcagaattccaaaacgttgcatcagcaggtattatcgttctactc
gttatcttattattgatgaacactgtagcgatacttcttcgtaataaatttagtaaaaaa
ttctaa

DBGET integrated database retrieval system