KEGG   Staphylococcus epidermidis ATCC 12228: SE1069Help
Entry
SE1069            CDS       T00110                                 

Definition
phosphate ABC transporter
Orthology
K02037  
phosphate transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080480..1081406)
Genome map
AA seq 308 aa AA seqDB search
MASQTKVREMIAKNNAKKGGLSDKIVPIILAIISAISILTTIAILFTLLTETITFFTRVP
LSKFFLSGTWNPTGSSPEFGIWALIIGTLKITVIATIVAVPIGLGAAIYLNEYASDRSRR
IIKPILEILAGIPTIVFGFFALTFVTPILRNLIPNLGEFNSISPGIVVGIMIVPMITSMS
EDAMSSVPDKIREGAFGLGATKFEVATKVVLPAATSGVVASIVLGISRAIGETMIVSLAA
GSSPTSSLSLTSSIQTMTGYIVEIATGDAAFGSDIYYSIYAVGFTLFIFTLIMNLLSQWI
SKRFREEY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacaaacaaaggtgagagaaatgatagctaagaataatgctaaaaagggcggg
ctaagtgataaaattgtcccaattattttagccattatttcagctatatctatattaact
acaattgctattttatttacacttttaaccgagacgattacgtttttcacacgagtgcca
ttatctaaattctttttatctggtacttggaacccaactggttcatcaccagaatttgga
atttgggcactcatcatcggcacattgaaaattactgttattgctacaatcgtagcagtt
ccgattggtttaggagcagctatctaccttaatgaatatgcatctgatcgttcacgtaga
atcattaaaccaatattagaaattttggctgggattcctacaattgtatttggcttcttt
gctttgacatttgttacacctatattgagaaatctaattcctaacttgggagagtttaat
tcaatcagtcccggtattgttgtgggtataatgattgtccctatgattacaagtatgagt
gaagatgcaatgtcatctgtacctgataaaattcgtgaaggtgcatttggattaggcgca
actaaatttgaagtcgctacaaaagttgtattaccagctgcgacttctggcgttgttgct
tcaattgtattaggtatatcaagagcaataggtgaaacaatgatcgtttctttagctgct
ggtagttcaccaacatcatctctaagtttaactagttcaattcaaacgatgacaggatat
attgttgaaattgctacaggtgatgcagcatttggttctgatatttactacagtatttac
gctgtaggttttacacttttcattttcactttaattatgaatttattatcacaatggatc
tctaaacgattcagagaggagtattaa

DBGET integrated database retrieval system