KEGG   Staphylococcus epidermidis ATCC 12228: SE1072Help
Entry
SE1072            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1084305..1085912
Genome map
AA seq 535 aa AA seqDB search
MLQVTDVSLRFGDRKLFEDVNIKFTEGNCYGLIGANGAGKSTFLKILSGEIDSQTGHVSL
GKDERLAVLKQDHFAYEDERVLDVVIKGHERLYQVMKEKDEIYMKPDFSDEDGIRAAELE
GEFAEMNGWNAEADAANLLSGLGIEPDLHDKNMSELENNQKVKVLLAQSLFGDPDVLLLD
EPTNGLDIPAISWLEDFLINFENTVIVVSHDRHFLNNVCTHIADLDFGKIKLYVGNYDFW
YQSSQLAQKMAQEQNKKKEEKMKELQDFIARFSANASKSKQATSRKKQLEKIELDDIQPS
SRRYPYVKFTPEREIGNDLLTVENLSKTIDGEKVLDNVSFTMNPNDKAILVGDSEIAKTT
LLKILAGEMEPDEGTFKWGVTTSLSYFPKDNSEFFDGVDMNLVEWLRQYAPEDEQTETFL
RGFLGRMLFSGEEVKKKASVLSGGEKVRCMLSKMMLSSANVLLLDEPTNHLDLESITAVN
DGLKSFKGSIIFTSYDFEFINTIANRVIDLNQAGALSKEVPYEEYLQEIGVLQNN
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttacaagtaactgatgtaagtttacgttttggtgatcgtaaactatttgaagatgta
aatataaaatttacagagggtaattgttatggattaattggtgcaaatggtgctgggaaa
tctacattcttgaagattttatcaggcgaaattgattcacagactggtcatgtatctcta
ggtaaagatgagcgtttggctgtgttaaaacaagatcattttgcttatgaagatgaacgt
gttttagatgttgtgattaaaggacatgaacgtttgtatcaagtgatgaaagagaaagat
gaaatttatatgaaacctgatttcagcgatgaggacggtattcgcgctgcagaacttgaa
ggagaatttgcagaaatgaacggttggaatgctgaagctgatgctgctaacttattatca
ggattaggcatagaacctgacttacatgataaaaatatgtctgaacttgaaaataatcaa
aaagttaaggtattgttagctcaaagtttatttggtgatcctgacgttcttttactagat
gagcctaccaatggtttagatataccagcaataagttggttagaagactttttaattaat
tttgaaaatactgtcattgtcgtttcgcatgaccgtcacttcttaaataatgtttgtact
catattgctgatttagactttggcaaaattaaactttatgttggtaactatgatttttgg
tatcaatcaagtcaattagcacaaaaaatggcacaagaacaaaataagaaaaaagaagaa
aaaatgaaagagttacaggatttcatcgcacgcttctcagcaaatgcttctaaatctaaa
caggcaacaagtcgtaagaaacaattagaaaaaattgaattagatgatatccagccatca
tctcgtagatacccttacgtgaaatttactcctgaacgtgaaattggaaatgatttactt
acagtagaaaatctttctaaaacaattgacggcgaaaaagtactagacaatgtttcattc
actatgaatcctaatgataaagctattttagttggtgatagcgaaattgctaaaacaaca
ttgttaaaaattttagctggagaaatggaaccagatgaaggtacatttaaatggggtgta
acgacatctttaagttacttccctaaagataactctgagttctttgatggtgtcgatatg
aatttagttgaatggttacgtcaatacgctccagaagatgaacaaactgaaacattttta
cgtggtttcttaggtcgcatgttatttagtggtgaggaagttaagaaaaaagcaagcgtg
ctttcaggtggagaaaaagtacgttgcatgttaagtaaaatgatgttatcaagtgctaac
gtacttttacttgatgagccaacaaaccatttagatttggaaagtatcactgctgtaaat
gacggattaaaatcatttaaaggttctatcatcttcacttcttatgattttgaatttatt
aatacaatcgcaaatcgagtgattgacttgaatcaagctggtgccctttctaaagaagta
ccttatgaggaatacttacaagaaattggtgtattacaaaataattaa

DBGET integrated database retrieval system