KEGG   Staphylococcus epidermidis ATCC 12228: SE1077Help
Entry
SE1077            CDS       T00110                                 

Definition
tetrahydrodipicolinate acetyltransferase
Orthology
K05822  
tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sep01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sep00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090411..1091133
Genome map
AA seq 240 aa AA seqDB search
MVQHLSAQEIIQYISDAKKSTPLKVYVNGHFENVTFPESFKVFGSEHSKVIFCEANEWKQ
FYQQNHSLITELEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
IGAIVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVVIEDNVLIGANAV
ILEGVRVGAGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQTSEVQDSKREIVSALRKLNNE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacatttatcagctcaagaaatcattcaatatattagtgatgctaagaaatca
acaccactcaaagtttatgtaaatggtcattttgaaaatgtcacattcccagaatctttt
aaagtttttggctctgaacattcaaaagtaattttctgtgaagcaaatgaatggaaacaa
ttttatcaacaaaatcattcattaatcactgaattagaaattgagatggatcgtcgtaat
tcagctataccgcttaaagatttaacaaacacaaatgctcgtattgagccaggtgcgttt
attcgtgagcaagcaatcattgaagatggtgctgtggttatgatgggtgctacgattaat
attggagctattgtaggagaaggaacaatgatagacatgaacgcaacacttggtggacga
gctacaacaggaaaaaatgttcatgttggtgcaggtgctgttttagctggtgtcattgaa
cctccaagtgcttccccagttgtcattgaagacaatgttttaattggagcaaatgctgtt
attcttgaaggtgtacgcgttggtgcaggtgctattgtagcagctggagctattgtaact
caagatgtgccagctggagctgtagttgctggtacgcctgctaaagtaattaaacaaact
tcagaagttcaagactcaaaacgtgagattgtgtctgcactgcgtaaattaaataatgaa
taa

DBGET integrated database retrieval system