KEGG   Staphylococcus epidermidis ATCC 12228: SE1077Help
Entry
SE1077            CDS       T00110                                 

Definition
tetrahydrodipicolinate acetyltransferase
Orthology
K05822  
tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE1077
  Amino acid metabolism
   00300 Lysine biosynthesis
    SE1077
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     SE1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090411..1091133
Genome map
AA seq 240 aa AA seqDB search
MVQHLSAQEIIQYISDAKKSTPLKVYVNGHFENVTFPESFKVFGSEHSKVIFCEANEWKQ
FYQQNHSLITELEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
IGAIVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVVIEDNVLIGANAV
ILEGVRVGAGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQTSEVQDSKREIVSALRKLNNE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacatttatcagctcaagaaatcattcaatatattagtgatgctaagaaatca
acaccactcaaagtttatgtaaatggtcattttgaaaatgtcacattcccagaatctttt
aaagtttttggctctgaacattcaaaagtaattttctgtgaagcaaatgaatggaaacaa
ttttatcaacaaaatcattcattaatcactgaattagaaattgagatggatcgtcgtaat
tcagctataccgcttaaagatttaacaaacacaaatgctcgtattgagccaggtgcgttt
attcgtgagcaagcaatcattgaagatggtgctgtggttatgatgggtgctacgattaat
attggagctattgtaggagaaggaacaatgatagacatgaacgcaacacttggtggacga
gctacaacaggaaaaaatgttcatgttggtgcaggtgctgttttagctggtgtcattgaa
cctccaagtgcttccccagttgtcattgaagacaatgttttaattggagcaaatgctgtt
attcttgaaggtgtacgcgttggtgcaggtgctattgtagcagctggagctattgtaact
caagatgtgccagctggagctgtagttgctggtacgcctgctaaagtaattaaacaaact
tcagaagttcaagactcaaaacgtgagattgtgtctgcactgcgtaaattaaataatgaa
taa

DBGET integrated database retrieval system