KEGG   Staphylococcus epidermidis ATCC 12228: SE1086Help
Entry
SE1086            CDS       T00110                                 

Definition
cold-shock protein CspA
Orthology
K03704  
cold shock protein (beta-ribbon, CspA family)
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Transcription factors [BR:sep03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SE1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1097883..1098083)
Genome map
AA seq 66 aa AA seqDB search
MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQEGYKSLEEGQSVEFEVVEGDRGPQA
ANVVKL
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggtacagttaaatggtttaatgccgaaaaaggttttggtttcatcgaagtt
gaaggagaaaacgacgtattcgtacacttctcagcaattaaccaagaaggatacaaatca
ttagaagaaggtcaatcagttgaatttgaagtagttgaaggcgatcgcggtcctcaagct
gcaaacgttgttaaactataa

DBGET integrated database retrieval system