KEGG   Staphylococcus epidermidis ATCC 12228: SE1096Help
Entry
SE1096            CDS       T00110                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE1096
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SE1096
  Amino acid metabolism
   00310 Lysine degradation
    SE1096
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SE1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1106864..1108126)
Genome map
AA seq 420 aa AA seqDB search
MAEVKVPELAESITEGTIAEWLKNVGDNVDKGEAILELETDKVNVEVVSEEAGVLSEQLA
EEGDTVEVGQAVAVVGEGQVNTSNDSSNESSQKDEAKEKETPKQSNPNSSESENTQDNSQ
QRINATPSARRHARKNGVDLSEVSGKGNDVLRKDDVENSQKSSSQTAKSESKSQNSGSKQ
SNNNPSKPVIREKMSRRKKTAAKKLLEVSNQTAMLTTFNEVDMTNVMDLRKRKKEQFIKD
HDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQFYDIGIAVSTDDGLLVPFVRD
CDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAAIL
GMHSIITRPIAVDKDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLLES
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaaagttccagaattagcagaatcaatcacagagggtaccattgcagaa
tggttaaaaaatgtaggcgataatgtagataaaggtgaagctatcttagaactagaaaca
gataaagttaacgtcgaagtagtttctgaagaagctggggtattatcagaacaattagcc
gaggaaggcgatacagttgaagtaggtcaagctgtagctgtagtaggagaaggacaagta
aacacatctaacgatagttctaacgaatcttcacaaaaagatgaagctaaagagaaagaa
acgccaaaacaatctaatccgaattctagtgaaagtgaaaatacacaagataatagccag
caacgtatcaatgcaacaccatctgcacgtcgacatgcgcgtaaaaatggcgttgattta
agcgaagtatccggaaaaggcaatgatgttctaagaaaagatgatgttgaaaatagtcaa
aaatcttcaagtcaaacagctaaaagtgaaagcaaatcacaaaacagtggttctaaacaa
tctaataacaatccatcaaaacctgttattcgtgaaaaaatgtctcgacgcaaaaaaact
gctgcaaaaaaattattagaagtatcaaatcaaacagctatgcttactacatttaatgaa
gttgatatgacaaacgttatggatttacgtaaacgtaaaaaagaacaatttatcaaagat
catgatggtactaaattaggatttatgtccttctttactaaagctgccgttgcagctctc
aaaaaatatcctgaagtaaatgctgagatagatggcgatgatatgattactaaacaattt
tacgatattggcattgcagtatccactgacgatggattactcgtaccatttgttagagat
tgtgataagaaaaattttgcagaaattgaacaagaaatcgctaatttagccgtaaaagct
cgtgataaaaaattaggccttgatgacatggttaacggttcgtttaccatcactaatggc
ggtatctttggctcaatgatgagtacaccgattataaatggtaatcaagcagctatctta
ggtatgcattcaattattacacgcccaattgcagttgataaagatacaattgaaaatcgt
ccaatgatgtatatcgcattaagctatgatcatagaatcatcgatgggaaagaggctgta
ggattcttaaaaacaatcaaagaactcattgaaaaccctgaagatttattacttgaatca
taa

DBGET integrated database retrieval system