KEGG   Staphylococcus epidermidis ATCC 12228: SE1096Help
Entry
SE1096            CDS       T00110                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE1096
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SE1096
  Amino acid metabolism
   00310 Lysine degradation
    SE1096
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SE1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1106864..1108126)
Genome map
AA seq 420 aa AA seqDB search
MAEVKVPELAESITEGTIAEWLKNVGDNVDKGEAILELETDKVNVEVVSEEAGVLSEQLA
EEGDTVEVGQAVAVVGEGQVNTSNDSSNESSQKDEAKEKETPKQSNPNSSESENTQDNSQ
QRINATPSARRHARKNGVDLSEVSGKGNDVLRKDDVENSQKSSSQTAKSESKSQNSGSKQ
SNNNPSKPVIREKMSRRKKTAAKKLLEVSNQTAMLTTFNEVDMTNVMDLRKRKKEQFIKD
HDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQFYDIGIAVSTDDGLLVPFVRD
CDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAAIL
GMHSIITRPIAVDKDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLLES
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaaagttccagaattagcagaatcaatcacagagggtaccattgcagaa
tggttaaaaaatgtaggcgataatgtagataaaggtgaagctatcttagaactagaaaca
gataaagttaacgtcgaagtagtttctgaagaagctggggtattatcagaacaattagcc
gaggaaggcgatacagttgaagtaggtcaagctgtagctgtagtaggagaaggacaagta
aacacatctaacgatagttctaacgaatcttcacaaaaagatgaagctaaagagaaagaa
acgccaaaacaatctaatccgaattctagtgaaagtgaaaatacacaagataatagccag
caacgtatcaatgcaacaccatctgcacgtcgacatgcgcgtaaaaatggcgttgattta
agcgaagtatccggaaaaggcaatgatgttctaagaaaagatgatgttgaaaatagtcaa
aaatcttcaagtcaaacagctaaaagtgaaagcaaatcacaaaacagtggttctaaacaa
tctaataacaatccatcaaaacctgttattcgtgaaaaaatgtctcgacgcaaaaaaact
gctgcaaaaaaattattagaagtatcaaatcaaacagctatgcttactacatttaatgaa
gttgatatgacaaacgttatggatttacgtaaacgtaaaaaagaacaatttatcaaagat
catgatggtactaaattaggatttatgtccttctttactaaagctgccgttgcagctctc
aaaaaatatcctgaagtaaatgctgagatagatggcgatgatatgattactaaacaattt
tacgatattggcattgcagtatccactgacgatggattactcgtaccatttgttagagat
tgtgataagaaaaattttgcagaaattgaacaagaaatcgctaatttagccgtaaaagct
cgtgataaaaaattaggccttgatgacatggttaacggttcgtttaccatcactaatggc
ggtatctttggctcaatgatgagtacaccgattataaatggtaatcaagcagctatctta
ggtatgcattcaattattacacgcccaattgcagttgataaagatacaattgaaaatcgt
ccaatgatgtatatcgcattaagctatgatcatagaatcatcgatgggaaagaggctgta
ggattcttaaaaacaatcaaagaactcattgaaaaccctgaagatttattacttgaatca
taa

DBGET integrated database retrieval system