KEGG   Staphylococcus epidermidis ATCC 12228: SE1100Help
Entry
SE1100            CDS       T00110                                 

Definition
(RefSeq) response regulator ArlR
  KO
K18941  
two-component system, OmpR family, response regulator ArlR
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Two-component system
Module
ArlS-ArlR (virulence regulation) two-component regulatory system
Multidrug resistance, efflux pump NorA
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SE1100
Two-component system [BR:sep02022]
 OmpR family
  ArlS-ArlR [MD:M00716]
   SE1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112731..1113390)
Genome map
AA seq 219 aa AA seqDB search
MTNILIVEDEQNLARFIELELTHENYTVDIENDGKVGLDKALSKPYDLYILDLMLPNING
LEICRQIRQKTTTPIIIITAKSETYDKVAGLDYGADDYIVKPFDIEELLARIRAVLRRQP
DKDVLDINGIIIDKDAFKVTVNGHQLELTKTEYDLLYVLAENRNHVMQREQILDHVWGYN
SEVETNVVDVYIRYLRNKLKPFNKEKSIETVRGVGYVIR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatattttaattgtagaagatgagcaaaatcttgctagatttatagagcttgag
ttaactcatgaaaattatactgttgatatagagaatgatggaaaggtgggtttggataaa
gcattatctaagccctatgatttatatatattagacttaatgcttccaaacataaatggt
ctagaaatttgtagacaaattcgtcaaaaaacaactactccaattatcatcattactgcg
aaaagcgagacatatgataaagtagctggattggactatggggcagatgactacattgta
aaaccctttgatatagaagaattgcttgcaagaataagagcggtattgcgcagacagcca
gataaagatgttttagatatcaatggtattatcattgataaagatgcctttaaagttact
gttaatggccatcaattagaattaactaaaacagaatacgatttactatatgttttagct
gaaaatcgtaaccacgtcatgcaacgtgaacaaattctcgatcacgtatgggggtataat
agtgaagtagaaacgaatgtcgttgatgtttatattcgttatttacgtaataaactcaaa
ccttttaataaagaaaaatccatagaaacagtacgtggcgtagggtatgtgattcgatga

DBGET integrated database retrieval system