KEGG   Staphylococcus epidermidis ATCC 12228: SE1108Help
Entry
SE1108            CDS       T00110                                 

Definition
multiple sugar-binding transport ATP-binding protein
Orthology
K10112  
multiple sugar transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
alpha-Glucoside transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1120468..1121559)
Genome map
AA seq 363 aa AA seqDB search
MIQIKDLNKVYDNGSYAVKDFNLDIEDNEFVVFVGPSGCGKSTTLRMIAGLEDVSKGTIS
INDKVINDLQPKDRKIAMVFQNYALYPHMTVYKNLAFGLKMRGIKKKIYDEKIQHAAQIL
EIENLLDRKPKALSGGQRQRVALGRAIVREAQIFLMDEPLSNLDAKLRSNMRSEIIKIHK
QMKATTIYVTHDQTEAMTMASRIVILKQGEIQQIGTPEEIYRHPVNEFVATFIGSPSMNM
VPMTYNMDAWYFDGQKVADATLLQLASHAQYRLGIRPEDLHLVNDNEISNYPIQLSQFTV
DLVELTGSYKLLHCHHNEHKIIAAVDSNLDFELGQTVSFGIKTEDAHFFDSDSGERVQEE
VLS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaatcaaggatttaaacaaagtttacgacaatggtagttacgcagttaaagat
ttcaatttagatattgaggacaatgaatttgtagtatttgtaggaccttcgggatgtggg
aaatcaacaacgttacgtatgattgcaggacttgaagatgtgagcaaagggacaattagt
atcaacgataaagtaatcaacgatttacaacctaaagatcgtaagattgctatggtcttt
caaaactatgcattatatccacatatgacagtttataaaaatttagctttcggcttaaaa
atgcgaggaatcaagaagaaaatttatgacgaaaaaattcaacatgcagctcaaatatta
gaaattgaaaacctcctcgaccgtaaacctaaagccttatctggaggacaacgtcaacgt
gtggcacttggtcgagctatcgttagagaagctcaaatctttctcatggatgaaccactt
tctaatttagatgctaaattacgaagtaacatgagaagcgaaattataaaaatacataaa
caaatgaaagcaacaacgatttacgtgacacacgaccaaactgaagctatgacaatggca
tcacgtatcgtcatattaaaacaaggcgaaatacaacaaattggtacgcctgaagaaatt
tatcgtcatcctgtcaatgaatttgttgccactttcattggtagcccatcaatgaatatg
gttccaatgacctacaacatggatgcttggtacttcgatggacaaaaagtggctgatgct
acattacttcagcttgcatcgcatgcacaatacagacttggtatacgacctgaagactta
catcttgttaatgataacgaaataagtaattatccaatccaactttctcaattcactgta
gacttagttgagttaactggttcatacaaattacttcactgtcatcacaatgagcataaa
atcatagcagctgtagatagtaatttggattttgaattaggacaaacagtttccttcggt
ataaaaacggaagatgcacactttttcgattctgattcaggcgaaagagtacaagaggag
gttttatcatga

DBGET integrated database retrieval system