KEGG   Staphylococcus epidermidis ATCC 12228: SE1108Help
Entry
SE1108            CDS       T00110                                 

Definition
(RefSeq) multiple sugar-binding transport ATP-binding protein
  KO
K10112  
multiple sugar transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
alpha-Glucoside transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE1108
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    SE1108
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    SE1108
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    SE1108
   alpha-Glucoside transporter [MD:M00201] [OT]
    SE1108
   Glucose/mannose transporter [MD:M00605] [OT]
    SE1108
   Cellobiose transporter [MD:M00206] [OT]
    SE1108
   N,N'-Diacetylchitobiose transporter [MD:M00606] [OT]
    SE1108
   Putative fructooligosaccharide transporter [MD:M00197] [OT]
    SE1108
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    SE1108
   Arabinosaccharide transporter [MD:M00602] [OT]
    SE1108
   Putative multiple sugar transporter [MD:M00207]
    SE1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1120468..1121559)
Genome map
AA seq 363 aa AA seqDB search
MIQIKDLNKVYDNGSYAVKDFNLDIEDNEFVVFVGPSGCGKSTTLRMIAGLEDVSKGTIS
INDKVINDLQPKDRKIAMVFQNYALYPHMTVYKNLAFGLKMRGIKKKIYDEKIQHAAQIL
EIENLLDRKPKALSGGQRQRVALGRAIVREAQIFLMDEPLSNLDAKLRSNMRSEIIKIHK
QMKATTIYVTHDQTEAMTMASRIVILKQGEIQQIGTPEEIYRHPVNEFVATFIGSPSMNM
VPMTYNMDAWYFDGQKVADATLLQLASHAQYRLGIRPEDLHLVNDNEISNYPIQLSQFTV
DLVELTGSYKLLHCHHNEHKIIAAVDSNLDFELGQTVSFGIKTEDAHFFDSDSGERVQEE
VLS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaatcaaggatttaaacaaagtttacgacaatggtagttacgcagttaaagat
ttcaatttagatattgaggacaatgaatttgtagtatttgtaggaccttcgggatgtggg
aaatcaacaacgttacgtatgattgcaggacttgaagatgtgagcaaagggacaattagt
atcaacgataaagtaatcaacgatttacaacctaaagatcgtaagattgctatggtcttt
caaaactatgcattatatccacatatgacagtttataaaaatttagctttcggcttaaaa
atgcgaggaatcaagaagaaaatttatgacgaaaaaattcaacatgcagctcaaatatta
gaaattgaaaacctcctcgaccgtaaacctaaagccttatctggaggacaacgtcaacgt
gtggcacttggtcgagctatcgttagagaagctcaaatctttctcatggatgaaccactt
tctaatttagatgctaaattacgaagtaacatgagaagcgaaattataaaaatacataaa
caaatgaaagcaacaacgatttacgtgacacacgaccaaactgaagctatgacaatggca
tcacgtatcgtcatattaaaacaaggcgaaatacaacaaattggtacgcctgaagaaatt
tatcgtcatcctgtcaatgaatttgttgccactttcattggtagcccatcaatgaatatg
gttccaatgacctacaacatggatgcttggtacttcgatggacaaaaagtggctgatgct
acattacttcagcttgcatcgcatgcacaatacagacttggtatacgacctgaagactta
catcttgttaatgataacgaaataagtaattatccaatccaactttctcaattcactgta
gacttagttgagttaactggttcatacaaattacttcactgtcatcacaatgagcataaa
atcatagcagctgtagatagtaatttggattttgaattaggacaaacagtttccttcggt
ataaaaacggaagatgcacactttttcgattctgattcaggcgaaagagtacaagaggag
gttttatcatga

DBGET integrated database retrieval system