KEGG   Staphylococcus epidermidis ATCC 12228: SE1114Help
Entry
SE1114            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YozE_SAM_like Terminase_6
Motif
Other DBs
NCBI-GeneID: 1056998
NCBI-ProteinID: NP_764669
UniProt: Q8CSK7
Position
complement(1126287..1126511)
Genome map
AA seq 74 aa AA seqDB search
MVKNYSFYQFIMTVRGRKDDKGVFAEQIFEDLAFPKHEDDFNTLSEYIETHSEFTLPMSV
FDDLYDDYTEWLKF
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaattattcattttatcaatttattatgaccgtgcgcggaagaaaagacgat
aaaggtgtttttgctgagcaaatttttgaagaccttgcctttccaaaacacgaagatgat
tttaatacattatctgaatatattgagacacatagcgaattcaccctaccaatgtctgta
tttgatgacttatatgatgactatacagaatggttgaagttttaa

DBGET integrated database retrieval system