KEGG   Staphylococcus epidermidis ATCC 12228: SE1121Help
Entry
SE1121            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K02003  
putative ABC transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Putative ABC transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1130731..1131393)
Genome map
AA seq 220 aa AA seqDB search
MLEFKQVSKSFRDGNQMIQAVKPTDLKIIQGELIAIVGPSGSGKSTFLTMAGALQRPTSG
NIYINNKNISILSEKQLSQIRINEIGFILQSTNLVPFLTIEQQFKLLGKYKKDTLSEDEY
QKLVKQLNLSDITNQLPNQISGGQKQRVAIAKAIYTNPSIILADEPTASLDTNNAMAVMK
ILQKQTKERNKTCVIVTHDERLTHFCDKTYFMEDGVLSLQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttagagttcaaacaagtgagcaaatctttcagagatggcaatcaaatgattcaggca
gtaaaacctaccgatttaaaaataattcagggggaactgattgctatcgtgggaccctca
ggttcagggaaaagtacatttttaactatggctggcgccttacaaagacctacgtcagga
aatatttacatcaataacaaaaatatatcaatattatctgaaaaacagttatctcaaata
agaattaacgaaataggttttatattacaatcgacgaatctcgtgccttttttaacaatc
gaacaacaattcaaacttcttggtaaatataaaaaagatacattaagtgaagatgaatac
caaaagttggttaaacagctaaatttatcggatattaccaatcaattaccaaatcaaata
tctggcggtcaaaaacagcgcgtggcaatagctaaagctatttacacaaatccatcaatc
atactagcagatgaacctaccgcttcactagatacgaataatgcaatggctgtaatgaaa
atacttcaaaaacaaacgaaagaaagaaataaaacatgtgtgattgttactcatgatgaa
cgtttaactcatttttgtgataaaacatatttcatggaggatggagttctttcactccaa
tag

DBGET integrated database retrieval system