KEGG   Staphylococcus epidermidis ATCC 12228: SE1121Help
Entry
SE1121            CDS       T00110                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
sep_M00258  Putative ABC transport system
Brite
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    SE1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 IstB_IS21 AAA_16 AAA_13 RNA_helicase AAA_22 AAA_25 AAA_33 AAA_24 AAA_18 AAA_23 RsgA_GTPase Cytidylate_kin AAA_14 AAA_30 T2SSE
Motif
Other DBs
NCBI-GeneID: 1057043
NCBI-ProteinID: NP_764676
UniProt: A0A0H2VHS6
Position
complement(1130731..1131393)
Genome map
AA seq 220 aa AA seqDB search
MLEFKQVSKSFRDGNQMIQAVKPTDLKIIQGELIAIVGPSGSGKSTFLTMAGALQRPTSG
NIYINNKNISILSEKQLSQIRINEIGFILQSTNLVPFLTIEQQFKLLGKYKKDTLSEDEY
QKLVKQLNLSDITNQLPNQISGGQKQRVAIAKAIYTNPSIILADEPTASLDTNNAMAVMK
ILQKQTKERNKTCVIVTHDERLTHFCDKTYFMEDGVLSLQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttagagttcaaacaagtgagcaaatctttcagagatggcaatcaaatgattcaggca
gtaaaacctaccgatttaaaaataattcagggggaactgattgctatcgtgggaccctca
ggttcagggaaaagtacatttttaactatggctggcgccttacaaagacctacgtcagga
aatatttacatcaataacaaaaatatatcaatattatctgaaaaacagttatctcaaata
agaattaacgaaataggttttatattacaatcgacgaatctcgtgccttttttaacaatc
gaacaacaattcaaacttcttggtaaatataaaaaagatacattaagtgaagatgaatac
caaaagttggttaaacagctaaatttatcggatattaccaatcaattaccaaatcaaata
tctggcggtcaaaaacagcgcgtggcaatagctaaagctatttacacaaatccatcaatc
atactagcagatgaacctaccgcttcactagatacgaataatgcaatggctgtaatgaaa
atacttcaaaaacaaacgaaagaaagaaataaaacatgtgtgattgttactcatgatgaa
cgtttaactcatttttgtgataaaacatatttcatggaggatggagttctttcactccaa
tag

DBGET integrated database retrieval system