KEGG   Staphylococcus epidermidis ATCC 12228: SE1140Help
Entry
SE1140            CDS       T00110                                 

Definition
endonuclease-like protein
Orthology
K10773  
endonuclease III [EC:4.2.99.18]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sep03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1178549..1179208)
Genome map
AA seq 219 aa AA seqDB search
MISKKKALQMIDVIADMFPNAECELNHRNAFDLTIAVLLSAQCTDNLVNRVTQSLFRKYR
TPEDYLNVSDEELQNDIRSIGLYRNKAKNIKKLCHSLIEQFNGQIPQTHKELESLAGVGR
KTANVVMSVAFGEPSLAVDTHVERVSKRLGINRWKDSVRQVEDRLCDIIPRDRWNKSHHQ
LIFFGRYHCLARKPKCEICPLLNDCREGQKRHKAKIKEA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaagaaaaaagcattacaaatgattgacgttatagcagatatgtttcctaat
gcagaatgcgaattaaaccatagaaatgcattcgatcttacaatagctgtattattatca
gcacagtgtactgataatctagtcaatcgtgtcactcaatcattatttagaaaatatcga
acacctgaagattatttaaatgtgagtgatgaagaattacaaaatgatatacgctctatt
ggattatatcgcaataaagccaaaaatataaaaaaattatgccactctttaattgaacaa
tttaatggtcaaatcccacaaacacataaagaattagagagtctagctggagtggggcgt
aaaacagcaaatgttgtaatgagtgtcgcatttggagaaccttctttagctgtcgatact
catgttgagagagtttctaaacgtttgggaattaatcgttggaaagatagtgtaagacaa
gtagaagatcgattatgtgatattatcccaagagatagatggaataaaagccatcatcaa
ttaatattttttgggagatatcattgtcttgctagaaaacctaaatgtgagatatgtccg
ctgttaaatgattgtagagaaggacaaaaacgacataaagcaaagataaaggaggcgtga

DBGET integrated database retrieval system