KEGG   Staphylococcus epidermidis ATCC 12228: SE1140Help
Entry
SE1140            CDS       T00110                                 

Definition
(RefSeq) endonuclease-like protein
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SE1140
Enzymes [BR:sep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SE1140
DNA repair and recombination proteins [BR:sep03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SE1140
 Prokaryotic Type
     SE1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S HPD AAA_32
Motif
Other DBs
NCBI-GeneID: 1057824
NCBI-ProteinID: NP_764695
UniProt: A0A0H2VGA4
Position
complement(1178549..1179208)
Genome map
AA seq 219 aa AA seqDB search
MISKKKALQMIDVIADMFPNAECELNHRNAFDLTIAVLLSAQCTDNLVNRVTQSLFRKYR
TPEDYLNVSDEELQNDIRSIGLYRNKAKNIKKLCHSLIEQFNGQIPQTHKELESLAGVGR
KTANVVMSVAFGEPSLAVDTHVERVSKRLGINRWKDSVRQVEDRLCDIIPRDRWNKSHHQ
LIFFGRYHCLARKPKCEICPLLNDCREGQKRHKAKIKEA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaagaaaaaagcattacaaatgattgacgttatagcagatatgtttcctaat
gcagaatgcgaattaaaccatagaaatgcattcgatcttacaatagctgtattattatca
gcacagtgtactgataatctagtcaatcgtgtcactcaatcattatttagaaaatatcga
acacctgaagattatttaaatgtgagtgatgaagaattacaaaatgatatacgctctatt
ggattatatcgcaataaagccaaaaatataaaaaaattatgccactctttaattgaacaa
tttaatggtcaaatcccacaaacacataaagaattagagagtctagctggagtggggcgt
aaaacagcaaatgttgtaatgagtgtcgcatttggagaaccttctttagctgtcgatact
catgttgagagagtttctaaacgtttgggaattaatcgttggaaagatagtgtaagacaa
gtagaagatcgattatgtgatattatcccaagagatagatggaataaaagccatcatcaa
ttaatattttttgggagatatcattgtcttgctagaaaacctaaatgtgagatatgtccg
ctgttaaatgattgtagagaaggacaaaaacgacataaagcaaagataaaggaggcgtga

DBGET integrated database retrieval system