KEGG   Staphylococcus epidermidis ATCC 12228: SE1158Help
Entry
SE1158            CDS       T00110                                 

Gene name
ubiE
Definition
ubiquinone/menaquinone biosynthesis methyltransferase
Orthology
K03183  
ubiquinone/menaquinone biosynthesis methyltransferase [EC:2.1.1.163 2.1.1.201]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SE1158 (ubiE)
Enzymes [BR:sep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.163  demethylmenaquinone methyltransferase
     SE1158 (ubiE)
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     SE1158 (ubiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1196705..1197430)
Genome map
AA seq 241 aa AA seqDB search
MAENQAKKEQVHTVFQNISQKYDRLNNIISFEQHKVWRKHVMSTMNVQKGSKALDVCCGT
ADWTIALSEAVGSKGQVTGLDFSENMLEVGKQKTASLENIQLVHGDAMNLPFDDNSFDYV
TIGFGLRNVPDYLSALKEMHRVLKPGGMVVCLETSQPTLPLFKQIYSLYFKFVMPIFGKM
FAKSKEEYEWLQQSTFNFPDKQTLKGLFFEAGFNDIIVRSFTGGVAAMHLGYKENSSSKG
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatcaagctaaaaaagaacaagttcatacagtattccaaaatatttctcaa
aaatacgatcgactcaacaacatcataagtttcgaacagcataaagtatggagaaaacat
gttatgagtactatgaatgtacaaaaaggcagtaaagctttagatgtgtgttgtggtact
gcagattggactattgcattaagcgaagcagtaggctcaaaaggccaagtaactggtctt
gattttagtgaaaatatgcttgaggtaggtaaacagaaaactgcttcattggaaaatatc
cagcttgttcatggtgatgctatgaatttaccttttgatgataactcatttgattatgtt
actattggttttggcttacgcaatgttccggattatttgtcagcactcaaagaaatgcat
cgagttttaaaaccaggaggcatggtggtatgtcttgaaacaagccaaccgacattgcca
ttattcaaacaaatctatagtttatactttaaatttgtgatgccaatttttggtaaaatg
tttgctaagtccaaagaagaatatgaatggttgcaacaatcaacatttaattttcctgac
aaacaaacattgaaaggcttattcttcgaagcaggatttaacgatatcattgtacgtagc
tttacaggtggcgttgctgcaatgcaccttggctataaagaaaacagttctagcaaaggt
gattaa

DBGET integrated database retrieval system