KEGG   Staphylococcus epidermidis ATCC 12228: SE1168Help
Entry
SE1168            CDS       T00110                                 

Definition
(RefSeq) thioredoxin reductase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 Pyr_redox HI0933_like FAD_binding_2 FAD_oxidored FAD_binding_3 Thi4 GIDA NAD_binding_8 DAO NAD_binding_7 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 1057877
NCBI-ProteinID: NP_764723
UniProt: A0A0H2VGB3
Position
complement(1205029..1206015)
Genome map
AA seq 328 aa AA seqDB search
MQTIESIIIGGGPCGLSAAIEQKKKGIETLVIEKGNVVESIYNYPTHQTFFSSSDKLSIG
DIPFIVEDSKPRRNQALVYYREVVKHHQLNIHPFEEVLTVKKINNKFAITTTKGVYECKY
LTVATGYYGQHNTLEAEGAELPKVFHYFKEAHPYFNQNVVIIGGKNSAVDAALELEKAGA
NVTVLYRGEQYPKAIKPWILPNFESLVNHEKITMEFNATVTKITDHSVTYEKDGQLIEID
NDYVFAMIGYHPDYDFLKTIGIDIHTNEYGTAPVYNRETFETNVENCYIAGVIAAGNDAN
TIFIENGKYHGGVITQSILTKKQTPLET
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactattgaaagcatcattataggtggcggtccatgcggattaagcgcggcaatt
gaacaaaagaaaaaaggtattgaaacattagtaattgaaaaaggtaatgttgttgaatca
atctataattatccaacacatcagacttttttctcatcaagtgataaattaagtatcggc
gatattccttttattgttgaagatagtaagccaagacgtaatcaagcgcttgtatattat
agggaagtcgttaaacatcatcaacttaacatacatccattcgaagaagttttaacagtt
aaaaaaataaacaataaatttgcaattacaactacaaaaggtgtatatgaatgtaaatat
ttaactgttgctacgggttattatggtcaacataacactttagaagcggaaggggcagaa
ttaccaaaagtattccattactttaaagaagcacatccgtattttaatcaaaatgttgtt
attattggaggcaaaaactctgctgttgatgctgccttagaattagaaaaagctggtgct
aatgtaactgttttatatcgtggcgaacagtaccctaaagcaattaaaccatggatatta
cccaatttcgaatcattagtcaatcacgaaaaaattacgatggaatttaatgcgacagta
accaaaattaccgatcattcagtgacttatgaaaaagatggtcaacttatagaaattgat
aatgactacgtttttgctatgattggttatcatccagattacgatttcttaaaaacaata
ggtattgatatccataccaatgaatatggaactgctcctgtttataatcgagaaacattc
gaaacaaacgtcgaaaattgttatatagctggtgttattgctgcgggtaatgatgcaaat
actatttttatcgaaaatggtaaatatcatggtggtgtcattacacaaagcattttgaca
aaaaaacaaacacctcttgaaacatag

DBGET integrated database retrieval system