KEGG   Staphylococcus epidermidis ATCC 12228: SE1175Help
Entry
SE1175            CDS       T00110                                 

Definition
respiratory response protein SrrB
Orthology
K07651  
two-component system, OmpR family, sensor histidine kinase ResE [EC:2.7.13.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Two-component system
Module
ResE-ResD (aerobic and anaerobic respiration) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sep02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1211908..1213674)
Genome map
AA seq 588 aa AA seqDB search
MNRLNSVVIKLWLTIILIVATVLILLSVSLITFIQYYFTQETENAIKEDAKRISSLVEKS
HNKTLAIQNSQTLIDGDGPGGLIIMKDMSEKPDSSYKDTKKQMFNEIKKSTKFKKVFKEG
EYETQNITIKNKGNSQSYLLLGYPMKAQKGAQSHYSGVFIYKDLKSIEDTNNAITIIILI
TAIIFTIASTIFAFFLSNRITKPLRQLKTQAQKVSEGDYSQISTVATKDEIGDLSRAFNN
MNVEIQEHIKAISSSKNIRDTLLNSMVEGVLGINNQREIILSNKMADDIMRHIDDFSKES
IEQQIEATFESQQNEYLELEINTRYYVFISSYIDRIQTNGRSGIVMVIRDMTNEHNLDQM
KKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIRDSLAIVLDESKRLNRLVNELLN
VARMDAEGLSVEKELQPIQHLLDKMESKYRMQSEELGLTMTFDSNNDEQLWNYDMDRMDQ
VLTNLIDNATRYTQAGDSIKISIDEDSDFNILTITDTGTGIAPEHLKQVFDRFYKVDAAR
KRGKQGTGLGLFICKMIIEEHGGRIDVESELGKGTSFIIRLPKSKQIS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgactaaatagtgttgttataaaactgtggttaactattattttaatagtagcg
acagttttaattttattaagtgtttcattaatcacttttatacaatattactttacgcaa
gaaacagaaaatgcaattaaagaagatgccaaaagaattagttcacttgttgagaagtct
cataacaaaacattagctatccaaaatagccaaacactcattgatggtgatggaccgggt
ggcctcattattatgaaagacatgagcgagaaaccagactcatcgtataaagacactaaa
aaacaaatgtttaatgaaataaaaaagagtactaaatttaaaaaagtgtttaaagaaggt
gagtatgaaactcaaaatattacaataaaaaataaaggtaattctcaatcttatcttttg
ctaggatacccaatgaaagctcaaaaaggtgctcaaagtcattatagtggtgtttttata
tataaagatttgaaatctatcgaagatacaaataatgctattacaattattatattaata
actgctattatatttactatagcaagcacaatatttgcattctttttatctaatagaata
acgaaacccttacgtcaattaaaaacacaagcacaaaaagtttctgaaggggattatagt
caaatttcaactgtcgctactaaagatgaaataggtgatttatcacgtgcatttaacaac
atgaacgtagaaattcaagaacatatcaaagcaatttcttcatctaagaatataagagat
acattattaaactctatggtagaaggcgttctaggcattaataatcaacgtgaaatcata
ttgtcgaacaagatggctgatgatattatgcgtcacattgatgatttttcaaaagaatct
attgaacagcaaattgaagcaacatttgaatcacaacagaatgagtatttagaattagaa
attaatacaaggtactatgtatttatctccagttatatagatagaattcaaacaaatggt
agaagtggtattgtcatggtcatccgtgatatgacaaatgaacataatcttgatcaaatg
aaaaaagattttatagcaaatgtatcacatgaattacgtacgccaatctctttattacag
ggttacactgagtccatagtagacggtatagttaccgaaccagatgaaatacgtgactca
ttagcaatcgttttagatgaatctaagcgacttaatcgtttagtcaatgaattactaaat
gtagctcgtatggatgctgaaggattatcagttgagaaggaattacaacctattcaacac
cttcttgataaaatggagtctaaatatcgcatgcaaagtgaagaattaggtttaacaatg
acgtttgattctaataatgacgaacaattatggaactatgatatggatagaatggaccaa
gtgttaactaatttaattgataacgcaacaagatatacacaagctggtgattctataaag
atttctattgatgaagattcagatttcaatattttaacaataactgatacaggcactggt
atagcgccggaacatctgaaacaagtatttgaccgtttttataaagtggacgctgctcga
aaaagaggtaagcaaggcaccggattaggacttttcatttgtaaaatgattattgaagaa
cacgggggacgtattgatgttgagagcgaattaggcaaaggtacttcatttattattaga
ctacctaaatcaaaacaaattagttag

DBGET integrated database retrieval system