KEGG   Staphylococcus epidermidis ATCC 12228: SE1183Help
Entry
SE1183            CDS       T00110                                 

Definition
ADP-ribose pyrophosphatase
Orthology
K01515  
ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SE1183
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     SE1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1218672..1219214)
Genome map
AA seq 180 aa AA seqDB search
MRLNEKTIDRTVIYNGSIIDLEVHDVELPDGSTSKRELVFHHGAVAVCAITPENEVLLVK
QFRKPADQPLLEIPAGKLEKGEDRKEAAIRELQEETGYIASDLQFVTNMYGSPGFSSEKL
SIYFTDQLTVGETNLDDDEFVELHKVPLSQIDSLLKDNKIEDAKTIIALQHLLLNYNHSK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagattaaacgaaaaaacaatcgatagaacagttatatataatggtagtattattgat
ttagaagtacatgatgttgaattacccgatggtagcacatctaaacgtgaacttgtattt
catcatggtgcggtggcagtgtgtgcaataactcctgaaaatgaagttttattagttaaa
caatttcgtaagcctgcagatcaaccacttttggaaattcccgcaggcaaattagaaaag
ggtgaagatcgtaaagaagcggctattagagaactacaagaagaaacaggatatattgct
tcagatttgcaatttgtcactaatatgtatgggtctcctggattttcaagtgaaaaactt
tctatatacttcacagaccaattaacggttggagaaaccaatttagatgatgatgaattt
gtggagcttcacaaagtacctttaagtcaaatcgattcattgttaaaagataataaaatt
gaggatgccaaaacaatcattgcattgcaacatctattattaaattataatcattctaaa
taa

DBGET integrated database retrieval system