KEGG   Staphylococcus epidermidis ATCC 12228: SE1184Help
Entry
SE1184            CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1219297..1220205
Genome map
AA seq 302 aa AA seqDB search
MQKNILKSGIEISELGLGCMSLGTDYKKAQPIIESAIDNGITYFDTADIYDQGVNEEIVG
KALKKYQNRDDIVIGTKVGNRLTDDGHMTWDPSKKHIKESVKGSLKRLGLNHLDLYQLHG
GTIDDPLDETISAFDELKQEGYIRAYGISSIRPNVIDYYLKNSQIETLMSQFNLIDNRPE
SLINDVHDKQVKILARGPVFKGLLTSKSVDVIDEKFKNGVLDYTQDELGSTIASIKELES
NLTALSFKYLTSHDAMGSIIVGASSVEQLEENVRNYYKEISLDQIKSARNRVKDIEYTQH
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaatattctaaaaagtggcatcgaaatttctgaacttgggttaggttgcatg
agtttaggcacagattataaaaaagcgcaaccaattattgaaagtgcaattgataatggt
attacgtattttgatactgcagatatttacgatcaaggagttaatgaagaaattgttggt
aaagccttaaaaaaatatcaaaatcgtgatgacatcgttatcggaactaaagttggaaat
cgattaactgacgatggacatatgacgtgggatccttcgaaaaaacatattaaagaaagt
gttaagggatcattgaaacgattaggattaaaccatttagacttatatcaattacatggc
ggaacaatagatgatcctctagacgaaactattagtgcatttgatgaattaaagcaagaa
ggatatattcgtgcatatggaatttcatctatacggcctaacgtgatagactattatctt
aaaaatagtcaaattgaaacacttatgtcccagtttaatttaatagataatcgccctgaa
agtcttattaatgacgttcatgataagcaagttaaaattctagcacgtggccctgtattt
aaaggtttattaacttcaaaaagtgttgatgttatagatgaaaaatttaaaaacggtgtg
ttagattacactcaagacgaattaggtagcacgattgcttctattaaagaattggaaagt
aatttaaccgcgttatcatttaaatatttaacttctcatgatgctatggggtcaattatt
gtaggagctagtagcgttgaacaacttgaagagaatgtccgcaattattataaagaaatc
agtttagatcaaatcaaatccgcacgtaatagagttaaagatattgaatatacacaacat
ttgaaataa

DBGET integrated database retrieval system