KEGG   Staphylococcus epidermidis ATCC 12228: SE1190Help
Entry
SE1190            CDS       T00110                                 

Definition
(RefSeq) AraC family transcriptional regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cass2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 1057797
NCBI-ProteinID: NP_764745
UniProt: A0A0H2VHW9
Position
1225232..1226122
Genome map
AA seq 296 aa AA seqDB search
MKVLDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGQSPEEYARAR
KMTIAANDVVNGASRLMDVAKKYRYANSNDFANDFSDFHGISPIQATTKKDELKIQQRLY
IKLSTTENAPYTYRLQETDDISLVGYSRFIPTEQLSNPFNIPDFLEDLLVDGYIKELKRY
NDTSPYELFVVSCPLEQGLEIFVGVPSERYPSHLESRFLPGRHYALFNLQGEIDYATNEA
WYYIESSLQLTLPYERNSLYVEIYPLDISFNDPFTKIQLWLPIKQEIYDLDEGYQN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttttggacgttatcaagcaaatacaacaggcaattgtatatattgaggatcgt
ttgttagagccttttaatttgcaagaattaagtgattacgttggtctttctccgtatcat
ttggatcaatcttttaagatgatagttggtcagtccccagaggaatatgcgcgtgcacgt
aaaatgacaatagcagcaaacgatgtagttaatggagctagtcgattaatggatgttgct
aagaaatatcgttatgcgaattctaatgatttcgcaaatgattttagcgattttcatggt
atctcacctattcaagctacaacaaaaaaagatgaactaaaaatacagcaacgactgtat
ataaaattatcaacgactgaaaatgcaccctatacatacagacttcaagagactgatgat
atttctttagttggctattcaagatttattcctactgagcaattatcaaatccatttaat
attccagactttttagaggatctattagtagatggttatattaaagaacttaaacgttat
aatgatacgagcccgtatgaattatttgtagtcagctgtcctctggaacaaggtttagaa
atatttgttggtgttccgagtgaacgttacccttcacatcttgaaagcagatttttacct
ggtcgccattatgcattgtttaatttacaaggtgaaattgattatgctacaaacgaggct
tggtattatattgagtctagcttgcaacttactttaccttatgagcgaaatagtttatat
gttgagatttatccacttgatatttcatttaatgacccattcactaagattcaattatgg
ttgcctattaaacaagaaatctatgatttagatgaaggttatcaaaattaa

DBGET integrated database retrieval system