KEGG   Staphylococcus epidermidis ATCC 12228: SE1190Help
Entry
SE1190            CDS       T00110                                 

Definition
AraC family transcriptional regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1225232..1226122
Genome map
AA seq 296 aa AA seqDB search
MKVLDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGQSPEEYARAR
KMTIAANDVVNGASRLMDVAKKYRYANSNDFANDFSDFHGISPIQATTKKDELKIQQRLY
IKLSTTENAPYTYRLQETDDISLVGYSRFIPTEQLSNPFNIPDFLEDLLVDGYIKELKRY
NDTSPYELFVVSCPLEQGLEIFVGVPSERYPSHLESRFLPGRHYALFNLQGEIDYATNEA
WYYIESSLQLTLPYERNSLYVEIYPLDISFNDPFTKIQLWLPIKQEIYDLDEGYQN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttttggacgttatcaagcaaatacaacaggcaattgtatatattgaggatcgt
ttgttagagccttttaatttgcaagaattaagtgattacgttggtctttctccgtatcat
ttggatcaatcttttaagatgatagttggtcagtccccagaggaatatgcgcgtgcacgt
aaaatgacaatagcagcaaacgatgtagttaatggagctagtcgattaatggatgttgct
aagaaatatcgttatgcgaattctaatgatttcgcaaatgattttagcgattttcatggt
atctcacctattcaagctacaacaaaaaaagatgaactaaaaatacagcaacgactgtat
ataaaattatcaacgactgaaaatgcaccctatacatacagacttcaagagactgatgat
atttctttagttggctattcaagatttattcctactgagcaattatcaaatccatttaat
attccagactttttagaggatctattagtagatggttatattaaagaacttaaacgttat
aatgatacgagcccgtatgaattatttgtagtcagctgtcctctggaacaaggtttagaa
atatttgttggtgttccgagtgaacgttacccttcacatcttgaaagcagatttttacct
ggtcgccattatgcattgtttaatttacaaggtgaaattgattatgctacaaacgaggct
tggtattatattgagtctagcttgcaacttactttaccttatgagcgaaatagtttatat
gttgagatttatccacttgatatttcatttaatgacccattcactaagattcaattatgg
ttgcctattaaacaagaaatctatgatttagatgaaggttatcaaaattaa

DBGET integrated database retrieval system