KEGG   Staphylococcus epidermidis ATCC 12228: SE1196Help
Entry
SE1196            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase E2
Orthology
K09699  
2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SE1196
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     SE1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1232830..1234149)
Genome map
AA seq 439 aa AA seqDB search
MDIKMPKLGESVHEGTIEQWLVSVGDHVDEYEPLCEVITDKVTAEVPSTISGTITELVVE
EGQTVNINTVICKIDSENGQNQTESANEFKEEQNQHSQSNVNVSQFENNPKTHESEVHTT
SSRANNNGRFSPVVFKLASEHDIDLTQVKGTGFEGRVTKKDIQNIINNPNDQEKEKEFKQ
TDKKDHSMNHGDFLHQSSTKNEDSPLSNERVVPVKGIRKAIAQNMVTSVSEIPHGWMMVE
ADATNLVQTRNYHKAQFKKNEGYNLTFFAFFVKAVAEALKANPLLNSTWQGDEIVIHKDI
NISIAVADDDKLYVPVIKNADEKSIKGIAREINDLATKARLGKLAQSDMQNGTFTVNNTG
SFGSVSSMGIINHPQAAILQVESVVKKPVVIDDMIAIRNMVNLCISIDHRILDGVQTGKF
MNLVKKKIEQYSIENTSIY
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttggatataaaaatgcctaagcttggtgaaagtgtgcatgaaggtacgattgaacaatgg
ttagtatcagtaggagatcatgtagatgagtatgaaccattatgtgaagttattacagat
aaagtaacagctgaagtgccttcaacaatttctggaacaataacagaattagtggttgaa
gaaggacaaactgtcaatattaacacggtgatttgtaaaatcgattcggaaaatggtcaa
aatcaaacagaatcggcaaatgagtttaaggaagaacaaaatcagcattctcaatcaaat
gtaaacgtgtcacaattcgaaaataatcctaaaactcatgaaagtgaggtacatacaacc
tctagtcgcgcaaataacaatggacgattttcaccagttgtctttaaattagcttctgaa
catgatattgatttaacacaagtcaaaggaactggttttgaaggtcgtgttactaagaag
gatattcaaaatattattaacaatccaaacgatcaagaaaaagagaaagaatttaaacaa
acagataaaaaagatcattcaatgaaccatggtgactttttacatcaatcctcaactaaa
aacgaagactcaccattatcaaatgaacgtgtcgtaccagttaaaggtattagaaaagct
atcgcacaaaatatggttactagtgtcagcgaaataccacacggttggatgatggttgaa
gctgatgcaacgaatttggttcagactagaaactatcataaagctcaatttaaaaagaat
gagggttacaatttaactttctttgcgttttttgtaaaagctgttgcagaggctttaaaa
gcaaatccattactcaatagtacatggcaaggagatgaaattgttatccacaaagatatt
aatatctctattgctgttgcagacgatgataagttgtatgtgccagtcattaaaaatgca
gatgaaaaatcaattaaaggtattgcgcgtgaaatcaatgatttagctactaaagcaaga
ttaggaaaattagcacaaagtgatatgcaaaacggtacatttacggttaataatactggt
tcttttggttctgtttcttcaatgggaatcattaatcatccacaagctgccattttacaa
gtagaatcagtcgttaagaaacctgtagttatagatgatatgattgcaattagaaatatg
gttaatttgtgtatttcaatcgatcatcgtattctcgatggtgttcaaacgggaaaattt
atgaatcttgttaagaaaaaaatagaacaatattctattgaaaatacttctatttattaa

DBGET integrated database retrieval system