KEGG   Staphylococcus epidermidis ATCC 12228: SE1198Help
Entry
SE1198            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase E1
Orthology
K00166  
2-oxoisovalerate dehydrogenase E1 component alpha subunit [EC:1.2.4.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SE1198
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     SE1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1235138..1236136)
Genome map
AA seq 332 aa AA seqDB search
MIDYKSAGLTEEDLKKIYKWMDLGRKTDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAM
QKGDISSPYYRDLAFVTYMGISPLDTMLSAFGKRDDINSGGKQMPSHFSHKEKGILSQSS
PVATQIPHSVGAALALKMDNKPNIATATVGEGSSNQGDFHEGMNFAAVHKLPFVCVIINN
KYAISVPDSLQYAAEKLSDRALGYGMHGIQVDGNDPIAVYKAMKEARERALAGEGPTLIE
AVTSRMTPHSSDDDDTYRTKEERDLLKQEDCNIKFKTALLDQGIINENWLSQLETEHKEL
INEATKSAEAAPYPSEEEALTYVYEEGGQQND
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatagattacaagtcagcaggccttacagaagaagacctcaaaaaaatatataaatgg
atggacttaggaagaaaaacagacgaaaggctatggttactcaatcgtgcaggtaaaatt
ccatttgttgtcagtggtcaagggcaggaagcaactcaaattggtatggcatatgcaatg
caaaaaggtgatatctcatcaccttattatcgtgatttagcatttgtcacttatatggga
atttctccattggatactatgttatcagcttttggaaaacgtgatgacattaactcagga
ggtaaacaaatgccttctcattttagtcacaaagaaaaaggcattttatctcaaagttct
ccagtagccactcaaataccacattctgtcggtgctgcattagcacttaaaatggataac
aagccaaatattgctactgcaacagttggagaaggcagttcaaatcaaggtgactttcac
gaaggtatgaactttgctgcagttcacaaattacctttcgtctgtgtaataattaacaat
aaatatgcgatatctgtaccagattcactacaatatgctgctgaaaagttatcagatcgt
gcattaggttacggtatgcatggaatacaggtagatggaaatgacccaattgcagtatac
aaagcgatgaaagaagcaagagaacgagcgctagcaggtgaaggtccaacattgatagaa
gctgtcacttcacgtatgacaccacattcatctgatgatgatgatacatatcgtacaaaa
gaagaaagagacctattgaaacaagaggattgtaatataaaatttaaaacggccttactc
gatcaaggcatcataaacgaaaattggttgagtcaattggaaacagagcataaagaactc
attaatgaagctactaaatctgctgaagcagcaccatatccttcagaagaagaagctttg
acatatgtttatgaagagggaggtcaacaaaatgactaa

DBGET integrated database retrieval system