KEGG   Staphylococcus epidermidis ATCC 12228: SE1198Help
Entry
SE1198            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase E1
Orthology
K00166  
2-oxoisovalerate dehydrogenase E1 component, alpha subunit [EC:1.2.4.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sep00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1235138..1236136)
Genome map
AA seq 332 aa AA seqDB search
MIDYKSAGLTEEDLKKIYKWMDLGRKTDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAM
QKGDISSPYYRDLAFVTYMGISPLDTMLSAFGKRDDINSGGKQMPSHFSHKEKGILSQSS
PVATQIPHSVGAALALKMDNKPNIATATVGEGSSNQGDFHEGMNFAAVHKLPFVCVIINN
KYAISVPDSLQYAAEKLSDRALGYGMHGIQVDGNDPIAVYKAMKEARERALAGEGPTLIE
AVTSRMTPHSSDDDDTYRTKEERDLLKQEDCNIKFKTALLDQGIINENWLSQLETEHKEL
INEATKSAEAAPYPSEEEALTYVYEEGGQQND
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatagattacaagtcagcaggccttacagaagaagacctcaaaaaaatatataaatgg
atggacttaggaagaaaaacagacgaaaggctatggttactcaatcgtgcaggtaaaatt
ccatttgttgtcagtggtcaagggcaggaagcaactcaaattggtatggcatatgcaatg
caaaaaggtgatatctcatcaccttattatcgtgatttagcatttgtcacttatatggga
atttctccattggatactatgttatcagcttttggaaaacgtgatgacattaactcagga
ggtaaacaaatgccttctcattttagtcacaaagaaaaaggcattttatctcaaagttct
ccagtagccactcaaataccacattctgtcggtgctgcattagcacttaaaatggataac
aagccaaatattgctactgcaacagttggagaaggcagttcaaatcaaggtgactttcac
gaaggtatgaactttgctgcagttcacaaattacctttcgtctgtgtaataattaacaat
aaatatgcgatatctgtaccagattcactacaatatgctgctgaaaagttatcagatcgt
gcattaggttacggtatgcatggaatacaggtagatggaaatgacccaattgcagtatac
aaagcgatgaaagaagcaagagaacgagcgctagcaggtgaaggtccaacattgatagaa
gctgtcacttcacgtatgacaccacattcatctgatgatgatgatacatatcgtacaaaa
gaagaaagagacctattgaaacaagaggattgtaatataaaatttaaaacggccttactc
gatcaaggcatcataaacgaaaattggttgagtcaattggaaacagagcataaagaactc
attaatgaagctactaaatctgctgaagcagcaccatatccttcagaagaagaagctttg
acatatgtttatgaagagggaggtcaacaaaatgactaa

DBGET integrated database retrieval system