KEGG   Staphylococcus epidermidis ATCC 12228: SE1207Help
Entry
SE1207            CDS       T00110                                 

Definition
acetyl-CoA carboxylase biotin carboxylase subunit (EC:6.4.1.2)
Orthology
K01961  
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE1207
   01212 Fatty acid metabolism
    SE1207
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SE1207
   00640 Propanoate metabolism
    SE1207
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SE1207
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    SE1207
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SE1207
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SE1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1243564..1244922)
Genome map
AA seq 452 aa AA seqDB search
MKKILIANRGEIAVRIIRAAHDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
NIPNILSIATSTGCDGVHPGYGFLAENGDFAELCEACQLKFIGPSYQSIQKMGIKDIAKA
EMIKANVPVVPGSEGLIQSIDDAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGY
RMTQQEAETAFGNGGLYLEKFIENFRHIEIQIIGDTYGNVIHLGERDCTIQRRMQKLVEE
APSPVLSEDKRQEMGNAAIRAAKAVNYENAGTIEFIYDLDDNQFYFMEMNTRIQVEHPVT
EMVTGVDLVKLQLKVAMGEALPFKQEDISINGHAIEFRINAENPYKNFMPSPGKITQYLA
PGGFGVRIESACYTNYTIPPYYDSMVAKLIVHEPTREESIMTGIRALSEYLVLGIDTTIP
FHLRLLNNHIFRSGEFNTKFLEKYNIMDDNNQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattttaatcgctaatcgtggtgaaatcgcagtaagaataataagagcggca
cacgatttaggtattcaaacagtagctatatactcagaaggtgacaaagatgcattacat
actcaaattgctgatgaagcatactgcgtcggtcctactttatcaaaagattcttattta
aatataccaaatattttatctatcgctacttctacaggatgtgatggtgttcatcctgga
tacggttttttggctgaaaatggtgattttgctgaattgtgtgaagcatgccaattaaaa
tttattgggccaagctatcaatcaattcagaaaatgggaataaaagatattgctaaagct
gaaatgattaaagccaatgtacctgtagtaccaggaagtgaaggacttattcaaagtata
gatgacgctaaaaaaatagctaaaaaaatcggctatccagttatcatcaaagccacagca
ggtggtggtggaaaaggtattcgggttgctcgtgatgagaaagaacttgaaactggttac
cgtatgacacaacaagaagctgaaaccgcgttcggaaatggtggtttatacttagaaaaa
tttatagaaaactttagacatatagagattcaaattattggcgatacttatggaaacgtt
atacatttaggtgaacgtgattgtacaattcaaagaagaatgcaaaagctcgttgaagaa
gcaccctcaccagtactaagtgaagataaacgccaagaaatgggtaatgctgcaattaga
gctgcaaaagctgtaaattatgaaaacgcaggtacaattgaatttatatatgatttagat
gataaccaattttatttcatggaaatgaatacacgtattcaagttgaacacccagtaact
gaaatggtaacaggagtagatttagtaaaattacaactcaaagttgctatgggtgaggcg
ttaccttttaaacaagaagatatttccattaacggtcacgctattgaatttcgaatcaat
gctgaaaatccttacaaaaactttatgccatcaccaggcaagattacccaatatcttgct
ccaggcggttttggagtgagaattgaatcagcatgttatactaattatacgataccacct
tactatgactccatggtggcaaaacttatagttcacgaacctacacgtgaagaatcaatt
atgacaggcattcgtgctttaagtgaatatcttgttttaggtatcgacactacgattcca
ttccacttaagacttctaaataatcatatttttagaagtggggaatttaatacaaaattc
ctagaaaagtataatattatggacgataataaccaatag

DBGET integrated database retrieval system