KEGG   Staphylococcus epidermidis ATCC 12228: SE1208Help
Entry
SE1208            CDS       T00110                                 

Definition
(RefSeq) acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00061  Fatty acid biosynthesis
sep00620  Pyruvate metabolism
sep00640  Propanoate metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
sep01212  Fatty acid metabolism
Module
sep_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SE1208
   00640 Propanoate metabolism
    SE1208
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SE1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_D23 Dicty_REP HlyD_3
Motif
Other DBs
NCBI-GeneID: 1057399
NCBI-ProteinID: NP_764763
UniProt: A0A0H2VGL1
Position
complement(1244922..1245389)
Genome map
AA seq 155 aa AA seqDB search
MNFKEIKELIEILDQSSLTEINIEDNKGSVVNLKKEKETEIVTPQVTQQPTQPINHTHNE
TQQKPSHSSKDEQSSDNEYNTINAPMVGTFYKSPSPDEEAYVQVGDKVTNESTVCILEAM
KLFNEIQAETTGEIIEILVEDGQMVEYGQPLFKVK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaaagaaataaaagaattaatcgaaattcttgatcaatctagtttaactgaa
ataaatattgaagataataaaggtagcgtagttaatttaaaaaaagaaaaagagactgaa
atagttacaccgcaagttactcaacaaccaactcaaccgataaatcatacgcataatgaa
acacaacaaaagccatcacatagctctaaagatgaacaaagtagtgataatgaatacaat
accattaatgcaccaatggttggtacattttataaatcaccttcaccagatgaagaagca
tacgttcaagttggagataaagttacgaatgaaagtactgtttgtatattagaagctatg
aaattatttaatgagattcaagccgaaacaacaggtgaaatcatagaaattttagtagaa
gacggacaaatggtagagtatggccagccgttatttaaggtgaaataa

DBGET integrated database retrieval system