KEGG   Staphylococcus epidermidis ATCC 12228: SE1220Help
Entry
SE1220            CDS       T00110                                 

Definition
(RefSeq) glycine dehydrogenase subunit 2 (EC:1.4.4.2)
  KO
K00283  
glycine dehydrogenase subunit 2 [EC:1.4.4.2]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE1220
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SE1220
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE1220
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     SE1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1254778..1256286)
Genome map
AA seq 502 aa AA seqDB search
MISKSSPLIFERSKKDRYAYSLPQNDIENISIASLLDDKYIRKHKAEFPEVSELDLVRHY
TELSNKNFGVDTGFYPLGSCTMKYNPKINEKVARISGFSESHPLQEEEHVQGSLEIIYSL
QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHEKNGQSHRDEVIVPDSAHGTNPASA
SFAGFKSVTVKSNQRGEVDIEDLKRVVNDNTAAIMLTNPNTLGIFEQNIIEIGKIVHEAG
GLLYYDGANLNAILDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVEKLASYLP
KPMVIKDNDRYKYDNDIPNSIGRVKPFYGNFGIYLRAYTYIRSMGANGLKEVSEAAVLNA
NYIKSRLKNHFEIPFNQYCKHEFVLSGTLQKQYGVRTLDMAKRLLDFGVHPPTIYFPLNV
EEGMMIEPTETESKETLDYFIDAMIQIADETKNDPDKVLEAPHTTIIDRLDETTAARKPI
LKFEELKDEKYKEHTNIDSEDN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgattagtaaatcaagtcctttaatatttgaaagatccaaaaaagatagatatgcgtat
tcattaccacaaaatgacattgagaatatcagtattgcttcactcttagatgataagtat
attcgtaaacataaggctgaatttcccgaggtttcagaattagatttagttagacattat
accgaactatcaaataaaaatttcggggtagatactggattttacccattaggttcttgt
acgatgaaatataatcctaaaatcaatgaaaaggtagcgcgtatttctggttttagtgaa
tctcatcctttacaagaagaagaacacgttcaaggttctcttgaaattatatatagttta
caagaagaattgaaggaaattactggtatggatgaagttaccctacaacctgctgcaggt
gcacatggtgagtggactgctttaatgattttcaaagcttatcatgaaaaaaatggacaa
agccatcgtgatgaagtaatagtgcctgattcagcacatggtactaatcctgcttctgcc
tcatttgctggatttaaatcagtaactgtaaaatctaatcaacgtggggaagttgacata
gaagatttaaaaagagtagtaaacgataatacagctgcaattatgttaactaatccaaat
acattaggtatatttgaacagaatattattgaaatagggaaaatcgttcatgaagcagga
ggtttattatattacgatggagcaaatttaaatgctattttagataaagtacgtcctggt
gatatgggctttgatgcggtacatcttaatttgcacaaaacattcactggtcctcatggc
ggtggtggaccaggatcaggaccagttggagtagtagagaaattagccagttatctacct
aagcctatggttataaaagataacgataggtataaatatgataatgatattccaaattca
attggacgagtaaaaccgttttatggaaatttcggcatttatttaagagcatatacttat
atcagatcaatgggagccaatggtttaaaagaagtatctgaagctgccgttcttaatgcg
aattatataaaatctcgccttaaaaatcactttgaaattccgttcaatcaatattgtaaa
catgaatttgtattaagtggaactttacaaaaacaatatggtgtcagaacattagatatg
gctaagcgactgttagattttggtgtgcatccacctacaatatattttcctctcaatgtc
gaagaaggaatgatgattgagccaacagaaactgaatctaaagaaacacttgattacttt
attgatgcgatgattcaaatcgctgacgaaacaaaaaatgatccagataaagttttagaa
gcaccacatacgactataattgatcgattagatgagaccactgcagcacgaaaaccaatt
cttaaatttgaagaacttaaggacgaaaagtataaagaacacacaaatattgattctgaa
gataattaa

DBGET integrated database retrieval system