KEGG   Staphylococcus epidermidis ATCC 12228: SE1242Help
Entry
SE1242            CDS       T00110                                 

Definition
ABC transporter
Orthology
K09816  
zinc transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Zinc transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1271651..1272499)
Genome map
AA seq 282 aa AA seqDB search
MIDALLNFDFIRYSLISGLLIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
IIPVFSVINPMWFGILFAVIGALLIEKLRTSFSNYQEIAIPIIMSAGIALSAIFISLADG
FNQEIVGLLFGSISAVNISDLTTIIIITIIVLIFIVLFYKELFILSFDEEYSKVIGIPKW
IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKGFKQLIALSVILGELSVIL
GLIIAFYMNISPGGVIVVLLVLMLILTMIIQKLKIKFKKGVV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgcgttattaaattttgattttattagatattctttgattagcggtctgctt
attggctttatcgcaccattaataggtgcatttattgtagttcggagactatctttaatt
gctgacgctttaagccacgtgacattaggtggtatttcctttggtatgtttttgcttacc
attattcccgttttctcagtaataaaccctatgtggtttggtattctttttgctgttatt
ggagcgttattaattgaaaaattaaggacttcgttttctaattatcaagaaattgcaatt
cctattataatgagcgctggtattgctctaagtgctatttttatttctctagcagatggt
tttaatcaagaaatcgtaggcctactatttggatcaattagtgcagtaaatattagtgat
ttaactacaattattatcattacaataattgttctcatatttattgttttattttataaa
gaattgtttattttatcatttgacgaagaatatagtaaggtcataggtataccaaagtgg
attcaatttttatttatagtaattgttgctatggtaatatctgcatcaatgagagttgta
ggtatattattagtaagcgcgttaataactcttcctatagcaatttcaatgagaataact
aaaggatttaaacaattaatagcattaagtgttatattaggagaattatctgtaattcta
ggattaattatagctttttatatgaatatatcacctggtggcgtcattgttgtactattg
gtattaatgctcatactaacgatgattattcagaagttaaaaattaagtttaaaaaggga
gtcgtttaa

DBGET integrated database retrieval system