KEGG   Staphylococcus epidermidis ATCC 12228: SE1242Help
Entry
SE1242            CDS       T00110                                 

Definition
(RefSeq) ABC transporter
  KO
K09816  zinc transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02010  ABC transporters
Module
sep_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE1242
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    SE1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC-3 FecCD
Motif
Other DBs
NCBI-GeneID: 1057366
NCBI-ProteinID: NP_764797
UniProt: A0A0H2VGG1
Position
complement(1271651..1272499)
Genome map
AA seq 282 aa AA seqDB search
MIDALLNFDFIRYSLISGLLIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
IIPVFSVINPMWFGILFAVIGALLIEKLRTSFSNYQEIAIPIIMSAGIALSAIFISLADG
FNQEIVGLLFGSISAVNISDLTTIIIITIIVLIFIVLFYKELFILSFDEEYSKVIGIPKW
IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKGFKQLIALSVILGELSVIL
GLIIAFYMNISPGGVIVVLLVLMLILTMIIQKLKIKFKKGVV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgcgttattaaattttgattttattagatattctttgattagcggtctgctt
attggctttatcgcaccattaataggtgcatttattgtagttcggagactatctttaatt
gctgacgctttaagccacgtgacattaggtggtatttcctttggtatgtttttgcttacc
attattcccgttttctcagtaataaaccctatgtggtttggtattctttttgctgttatt
ggagcgttattaattgaaaaattaaggacttcgttttctaattatcaagaaattgcaatt
cctattataatgagcgctggtattgctctaagtgctatttttatttctctagcagatggt
tttaatcaagaaatcgtaggcctactatttggatcaattagtgcagtaaatattagtgat
ttaactacaattattatcattacaataattgttctcatatttattgttttattttataaa
gaattgtttattttatcatttgacgaagaatatagtaaggtcataggtataccaaagtgg
attcaatttttatttatagtaattgttgctatggtaatatctgcatcaatgagagttgta
ggtatattattagtaagcgcgttaataactcttcctatagcaatttcaatgagaataact
aaaggatttaaacaattaatagcattaagtgttatattaggagaattatctgtaattcta
ggattaattatagctttttatatgaatatatcacctggtggcgtcattgttgtactattg
gtattaatgctcatactaacgatgattattcagaagttaaaaattaagtttaaaaaggga
gtcgtttaa

DBGET integrated database retrieval system