KEGG   Staphylococcus epidermidis ATCC 12228: SE1243Help
Entry
SE1243            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K09817  
zinc transport system ATP-binding protein [EC:3.6.3.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Zinc transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1272533..1273324)
Genome map
AA seq 263 aa AA seqDB search
MKTMTTPVFELRNLDYYFDNKHVLENINIKINQGEFLAIVGPNGAGKSTLLKVILGLLPI
QKGEIIVDGKPFKGNKSSLKISYVSQKASAFNAGFPASVKEVVLSGLTKTKKLFQRFNKN
DYQKVTKVLERLNISHLINKNIAELSGGQQQRVLIARALISDPSVLVLDEPTNGIDAKHV
SKFYDTLDKLKKQGITIILVTHDIGVVADTATEVACLNKHLHFHGSTEAFKSLDEVEISK
IYGHPIQFVDHQHNRTCCNEGNE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccatgacaacaccagtttttgaattacgaaatttagattattatttcgataat
aagcatgtattagagaacataaatatcaaaattaatcagggagaatttttagcaattgtt
ggtccgaacggggcaggcaaatctactttactaaaagttatactagggctattgcctata
caaaagggcgagataattgttgatggaaaaccatttaaaggtaataaatcttcattgaaa
attagctatgtttctcaaaaagcttctgccttcaatgcaggtttcccagctagtgtaaag
gaagttgttttaagtggtctgactaaaacaaaaaaattatttcaaagatttaataaaaat
gactatcaaaaagtcacaaaggtattagagagattaaatatatctcatttaataaataaa
aatatagctgaactatctggtggtcaacaacaacgtgtacttattgctagagcacttatt
tcagacccaagtgtgctagtgttagatgaacctacaaacggaattgatgcaaaacatgta
agcaaattttacgatacacttgataaattaaaaaaacaggggattacaataattttagtc
actcacgatattggcgttgtagcagataccgctactgaagtagcatgtttaaataaacat
cttcatttccacggttccacagaagcatttaagtctttagatgaagttgaaatttcaaaa
atttatggtcatcctattcaatttgttgatcatcaacacaaccgaacatgttgtaatgag
ggaaatgaataa

DBGET integrated database retrieval system