KEGG   Staphylococcus epidermidis ATCC 12228: SE1348Help
Entry
SE1348            CDS       T00110                                 

Gene name
engB
Definition
(RefSeq) ribosome biogenesis GTP-binding protein YsxC
  KO
K03978  
GTP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Chromosome [BR:sep03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SE1348 (engB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1377974..1378561)
Genome map
AA seq 195 aa AA seqDB search
MNINFNNINLIISAVKKAQYPDTGLTEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
TQTLNFYNIDEQLIFVDVPGYGYAKVSKVQREKFGKMIEEYITQRENLKLVIQLVDLRHQ
PTEDDVLMYNYLKHFDIPTLVICTKEDKIAKGKVQKHIKRIKDKLELESGDNIISYSSIK
NSKQQEIWNFIETYI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaattttaataatattaacttaattataagtgctgtaaaaaaagcacagtat
cctgacactggattaacagaagtagcgttaagtggacgctcaaatgtagggaaatctaca
tttattaatagtatgattgggcgtaaaaatatggcgagaacgtcacaacaacctggtaag
acacagacattgaatttctataatatagatgaacaacttatttttgttgatgtaccagga
tatggatacgctaaagtaagtaaagttcaacgagaaaaatttggtaaaatgattgaagaa
tatattacacaacgagagaatttaaaacttgttattcaacttgtcgatttaagacatcaa
cctactgaagatgatgtgcttatgtacaattatcttaaacattttgatataccaacactt
gtaatatgtactaaagaagataaaattgccaaaggaaaagtacaaaagcatatcaaaaga
ataaaagacaaattagaattagaatctggagataatattataagttattcttcaattaaa
aatagtaaacagcaagaaatttggaactttattgaaacatatatataa

DBGET integrated database retrieval system