KEGG   Staphylococcus epidermidis ATCC 12228: SE1348Help
Entry
SE1348            CDS       T00110                                 

Gene name
engB
Definition
(RefSeq) ribosome biogenesis GTP-binding protein YsxC
  KO
K03978  GTP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Chromosome and associated proteins [BR:sep03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SE1348 (engB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 FeoB_N Dynamin_N RsgA_GTPase AIG1 Septin IIGP GTP_EFTU USP7_ICP0_bdg cobW RNA_helicase ABC_tran AAA_29 RB_B
Motif
Other DBs
NCBI-GeneID: 1056296
NCBI-ProteinID: NP_764903
UniProt: Q8CS80
Position
complement(1377974..1378561)
Genome map
AA seq 195 aa AA seqDB search
MNINFNNINLIISAVKKAQYPDTGLTEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
TQTLNFYNIDEQLIFVDVPGYGYAKVSKVQREKFGKMIEEYITQRENLKLVIQLVDLRHQ
PTEDDVLMYNYLKHFDIPTLVICTKEDKIAKGKVQKHIKRIKDKLELESGDNIISYSSIK
NSKQQEIWNFIETYI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaattttaataatattaacttaattataagtgctgtaaaaaaagcacagtat
cctgacactggattaacagaagtagcgttaagtggacgctcaaatgtagggaaatctaca
tttattaatagtatgattgggcgtaaaaatatggcgagaacgtcacaacaacctggtaag
acacagacattgaatttctataatatagatgaacaacttatttttgttgatgtaccagga
tatggatacgctaaagtaagtaaagttcaacgagaaaaatttggtaaaatgattgaagaa
tatattacacaacgagagaatttaaaacttgttattcaacttgtcgatttaagacatcaa
cctactgaagatgatgtgcttatgtacaattatcttaaacattttgatataccaacactt
gtaatatgtactaaagaagataaaattgccaaaggaaaagtacaaaagcatatcaaaaga
ataaaagacaaattagaattagaatctggagataatattataagttattcttcaattaaa
aatagtaaacagcaagaaatttggaactttattgaaacatatatataa

DBGET integrated database retrieval system