KEGG   Staphylococcus epidermidis ATCC 12228: SE1357Help
Entry
SE1357            CDS       T00110                                 

Gene name
thrS
Definition
threonyl-tRNA synthetase
Orthology
K01868  
threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SE1357 (thrS)
Enzymes [BR:sep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     SE1357 (thrS)
Amino acid related enzymes [BR:sep01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   SE1357 (thrS)
Transfer RNA biogenesis [BR:sep03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SE1357 (thrS)
 Prokaryotic Type
    SE1357 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1386955..1388892)
Genome map
AA seq 645 aa AA seqDB search
MNQINIQFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTRPLEQDGAIE
IITPGSEEALEVLRHSTAHLMAQALKRLYGDVKFGVGPVIEGGFYYDFDMDDKVSSDDFD
KIEKTMKQIVNENHKIVREVVSKEKAKDFFKDDPYKLELIDAIPEDESVTLYTQGEFTDL
CRGVHVPSTSKIKEFKLLSTAGAYWRGNSDNKMLQRIYGTAFFDKKDLKAHLKMLEERRE
RDHRKIGKDLELFTNNQLVGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLAN
VDLYKTSGHWDHYQEDMFPAMKLDEDEAMVLRPMNCPHHMMIYKNKPHSYRELPIRIAEL
GTMHRYEASGAVSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIQDVYKDFGFEDYRF
RLSYRDPEDKHKYFDDDEMWEKAESMLKEASDELGLTYEEAIGEAAFYGPKLDVQVKTAM
GKEETLSTAQLDFLLPERFDLTYIGQDGEQHRPVVIHRGVVSTMERFVAFLTEETKGAFP
TWLAPMQVEIIPVNIDLHYDYARLLQDELKSQGVRVEIDDRNEKMGYKIREAQMKKIPYQ
IVVGDQEVEHQEVNVRKYGSEKQESVEKDEFIWNVIDEIRLKKHR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaattaatattcaatttccagatggtaatacaaaagaatttgataaagggact
actacagaagacatcgctcaatcaattagtccaggattaagaaaaaaagcagttgcggga
aaattcaatggtcaacttgtagatttaacacgccctttagaacaagatggagctattgaa
attattactcctgggagtgaagaagcgttagaagtacttcgtcattcaacagctcattta
atggcacaagcattaaaacgtttatacggagacgttaaatttggagttggacctgtaata
gaaggcggattctattatgattttgatatggatgataaggtttcatcggatgattttgat
aaaattgagaaaacaatgaaacaaattgtgaacgaaaatcataaaattgtaagagaagta
gttagtaaagaaaaagcaaaagacttcttcaaggatgacccttataaattagaacttatt
gatgcaattcctgaagatgagagtgtaacactttatactcaaggtgaatttactgattta
tgtcgaggtgtacacgtaccttctacttctaaaattaaagagttcaaactattatctaca
gctggtgcttattggcgtggaaatagtgataataaaatgttacaacgaatttatggtaca
gcattctttgacaaaaaagatttgaaagcacatctaaaaatgttggaagaacgtcgtgag
cgtgatcatcgtaaaattggtaaagatttagaattgtttacaaacaatcaactcgttggt
gctggtttaccattatggttaccaaatggtgctacaatacgtagggaaatagaacgttat
attgtcgataaagaagtaagtatgggatacgatcatgtttacacaccagtattagccaat
gttgatttatataaaacatctggtcactgggatcattatcaagaagatatgttcccagca
atgaagttagatgaagacgaagcaatggtcttaagaccaatgaactgtccacatcatatg
atgatttataaaaacaaacctcattcttatcgcgaattacctatacgtattgctgaattg
ggtactatgcatcgttacgaagcaagtggtgcagtatcaggtttacaacgtgttcgagga
atgacattgaatgattcccatattttcgttagacctgatcaaattaaagaagaatttaaa
cgtgtagttaatatgattcaagatgtgtacaaagattttggttttgaagattatcgcttc
agattgagttatagagatcctgaagataagcataagtactttgatgatgatgaaatgtgg
gaaaaagctgaatccatgcttaaagaagcatcagatgaattaggtttaacttatgaagaa
gctattggtgaggcagcattctatggacctaagttagatgttcaagtaaaaacagctatg
ggaaaagaagaaactctatcaacagcacaacttgattttcttttaccagaacgttttgac
ttaacgtacattggtcaagatggagaacaacatcgtcctgtagttatacaccgtggtgta
gtttctactatggaacgttttgttgcatttttaacagaagaaacaaaaggtgcatttcca
acttggttggcgcctatgcaagttgaaattattcctgtaaatatagatttacattatgat
tatgcaagacttttacaagatgaactaaaatcgcaaggtgtccgcgttgaaattgatgac
cgtaatgaaaaaatgggatataaaattcgtgaagctcaaatgaaaaaaataccttatcag
attgttgtaggtgaccaagaagtagagcatcaagaagtaaatgtaagaaaatatggttct
gaaaaacaagaatcagttgaaaaagatgaatttatttggaatgttattgatgaaatccgt
ttgaaaaagcatagataa

DBGET integrated database retrieval system