KEGG   Staphylococcus epidermidis ATCC 12228: SE1369Help
Entry
SE1369            CDS       T00110                                 

Definition
alkaline phosphatase synthesis transcriptional regulatory protein
Orthology
K07658  
two-component system, OmpR family, alkaline phosphatase synthesis response regulator PhoP
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Two-component system
Module
PhoR-PhoB (phosphate starvation response) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sep02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1400532..1401242)
Genome map
AA seq 236 aa AA seqDB search
MSQKILVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALKKVETEQPELIVLDVMLPKKD
GIEVCKTIRSDKNLVPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAILRR
SQFVNEIEKEDVDDEDIIIGSIRIRPEFFEVYKEDELLELTPKEFELLLYLIERQGRVIT
REHMLNSVWNYEFAGDSRIVDVHISHLRDKLEENPKQPKLIKTVRGLGYKLERPKA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaaatattagtggttgatgatgagcaatccatcgtgaccttactaaaatat
aatttagaaacagcagggtatatagtcgaagtcgcttatgatggtgaagaggcattgaaa
aaagttgaaacagaacaaccggaactaattgtattagacgttatgttgccaaaaaaagat
ggtatagaagtatgtaaaacaatcaggtctgataaaaatttagtaccgattttaatgttg
acagcaaaggacgatgaatttgatcgagttttagggcttgaactaggtgctgatgactat
atgacaaaaccattttcacctagagaggtagttgccagagttaaagcaatattaagacgt
tctcaatttgtaaatgaaattgagaaggaagatgttgatgatgaagatattatcattggt
tcaattagaattcgacctgaattctttgaagtctataaagaagatgaattattagaattg
acgccaaaagaatttgaattgttattatatttaattgaaagacaaggaagagttattact
cgagaacatatgttgaattcagtgtggaattatgaattcgctggagattctcgaattgtt
gatgtacatataagccacttaagagataaattggaagaaaatcctaagcaacctaaattg
ataaagactgtacgtggtttaggttataaactggagagacctaaagcttaa

DBGET integrated database retrieval system