KEGG   Staphylococcus epidermidis ATCC 12228: SE1379Help
Entry
SE1379            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K06881  
phosphoesterase RecJ domain-containing protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1415658..1416596)
Genome map
AA seq 312 aa AA seqDB search
MEVKMNEIMEALEQSELIIIHRHLRPDPDAYGSQLGLKYYLQKKFPNKQIYAVGANEDSL
KFIGLMDEIDDDMYKKATVVVCDTANAPRIDDQRYDTGTKLLKIDHHPATDQYGDINYVN
TKASSTSEIIYEFILHFNDEHIIDEQVARVLYLGIVGDTGRFLFNNTTPRTMQIAGKLLT
YPFDHNQELNKMSEKDPKLLPFQGYILQNFDLNDKGFCKVKITKDILEKFQIQPNEASLF
VNTIADIRGLKIWMFGVDEGDQIRCRLRSKGHIIINDVANTFGGGGHPNASGVSVNSWEQ
FEQLAEALNDKL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaatgaatgaaataatggaagcattagaacaaagtgaattaattattatt
cacagacatctaagaccagatccagacgcatatggttcgcaattaggtttgaaatattac
ttacaaaagaagtttccaaacaaacaaatttatgcagtaggagctaatgaagattctttg
aaattcataggtttgatggacgaaattgacgatgatatgtacaagaaagcgactgtagtt
gtatgtgatacggcaaatgcgccaagaatagatgaccaacgttatgatacaggtaccaaa
cttttaaaaattgatcatcatcctgctactgatcagtatggagatattaactatgttaat
accaaagcttcttccactagtgaaataatttacgaattcattttacatttcaatgatgaa
catatcattgatgaacaagttgctagagtattatatcttggcatcgtcggtgatactgga
cgttttttatttaataatacaacgccacgaacaatgcaaattgctggaaaattacttaca
tatccttttgatcacaaccaagaattaaacaaaatgtctgaaaaggatccaaaactatta
ccatttcaaggatatatattgcaaaattttgatttaaatgataaaggattttgcaaagtt
aaaataactaaagacatacttgaaaaatttcaaatacaacctaatgaagcgtctttattt
gtaaatacaatcgcagatattcgaggattaaaaatatggatgtttggcgttgatgaagga
gatcaaattagatgtcggttgcgttctaaaggtcatattattattaatgatgtcgctaat
acatttggtggtggtggacatccaaatgcatctggagtttcagtaaatagttgggagcaa
ttcgagcaactcgccgaagctttaaacgacaagttataa

DBGET integrated database retrieval system