KEGG   Staphylococcus epidermidis ATCC 12228: SE1379Help
Entry
SE1379            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
  KO
K06881  
bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SE1379
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SE1379
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     SE1379
DNA repair and recombination proteins [BR:sep03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Others
    SE1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1415658..1416596)
Genome map
AA seq 312 aa AA seqDB search
MEVKMNEIMEALEQSELIIIHRHLRPDPDAYGSQLGLKYYLQKKFPNKQIYAVGANEDSL
KFIGLMDEIDDDMYKKATVVVCDTANAPRIDDQRYDTGTKLLKIDHHPATDQYGDINYVN
TKASSTSEIIYEFILHFNDEHIIDEQVARVLYLGIVGDTGRFLFNNTTPRTMQIAGKLLT
YPFDHNQELNKMSEKDPKLLPFQGYILQNFDLNDKGFCKVKITKDILEKFQIQPNEASLF
VNTIADIRGLKIWMFGVDEGDQIRCRLRSKGHIIINDVANTFGGGGHPNASGVSVNSWEQ
FEQLAEALNDKL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaatgaatgaaataatggaagcattagaacaaagtgaattaattattatt
cacagacatctaagaccagatccagacgcatatggttcgcaattaggtttgaaatattac
ttacaaaagaagtttccaaacaaacaaatttatgcagtaggagctaatgaagattctttg
aaattcataggtttgatggacgaaattgacgatgatatgtacaagaaagcgactgtagtt
gtatgtgatacggcaaatgcgccaagaatagatgaccaacgttatgatacaggtaccaaa
cttttaaaaattgatcatcatcctgctactgatcagtatggagatattaactatgttaat
accaaagcttcttccactagtgaaataatttacgaattcattttacatttcaatgatgaa
catatcattgatgaacaagttgctagagtattatatcttggcatcgtcggtgatactgga
cgttttttatttaataatacaacgccacgaacaatgcaaattgctggaaaattacttaca
tatccttttgatcacaaccaagaattaaacaaaatgtctgaaaaggatccaaaactatta
ccatttcaaggatatatattgcaaaattttgatttaaatgataaaggattttgcaaagtt
aaaataactaaagacatacttgaaaaatttcaaatacaacctaatgaagcgtctttattt
gtaaatacaatcgcagatattcgaggattaaaaatatggatgtttggcgttgatgaagga
gatcaaattagatgtcggttgcgttctaaaggtcatattattattaatgatgtcgctaat
acatttggtggtggtggacatccaaatgcatctggagtttcagtaaatagttgggagcaa
ttcgagcaactcgccgaagctttaaacgacaagttataa

DBGET integrated database retrieval system