KEGG   Staphylococcus epidermidis ATCC 12228: SE1392Help
Entry
SE1392            CDS       T00110                                 

Definition
iron-sulfur cofactor synthesis protein nifZ
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Thiamine metabolism
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:sep00730]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:sep04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1428401..1429549)
Genome map
AA seq 382 aa AA seqDB search
MLSVIYLDNAATTKADQDVVDSFVKVNQTLYFNPNSPHHAGVQAEQLLLKAKSEINRILN
LNNQFDIIFTSGATESNNILLKGIAYMKKETANEIITSVLEHPSVLEVMRYLEREKGFKL
KYVDVTKEGKLDTEHLKSLMTDKVGLVTCMYVNNIMGQIQPIEEIANIVKNYPRAHFHVD
AVQALGKVPMQINHIDSLSLSGHKFNGLKGQGLLLLKNIQNIEPIVHGGGQEYGLRSGTI
NLPMAISMVRAIKNAVDQTKELNLRLSNYKNKLLSFLAEYKNVFINSPQNASPHIINIGF
PGVKGEVLVNAFSKQNVMVSTTSACSSKMNKLNEVLLAMEIAESKIEGSIRISLGAHTTE
NDILSFMNAFESVYKEIKELLK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgttatcagtgatttatttagacaatgcagccactaccaaagctgatcaagatgttgtt
gattcattcgtgaaagtgaaccaaacattatacttcaatccaaatagtcctcatcatgca
ggggttcaagctgaacaattattattaaaagcaaaaagtgaaatcaatcgtatattaaac
ttaaataatcagtttgatatcatttttacaagtggcgcaactgaatcgaataatatactg
ctaaaaggtattgcgtatatgaaaaaagaaactgctaatgagattatcacatcagtctta
gaacatccttcagttttggaagtaatgaggtatttggaaagggaaaaaggttttaaatta
aaatacgttgatgtgacaaaagaaggtaagttggacacagaacacttaaaatcattaatg
acagataaagtaggacttgtgacatgtatgtatgtcaataatattatgggacaaattcaa
cctattgaagaaatagcaaatattgtaaaaaattacccacgtgcacactttcatgttgat
gcagtccaggctttaggtaaagtgcctatgcaaattaatcatattgatagtttgagttta
agtggtcataagtttaatggacttaaaggtcagggactactacttttaaaaaatattcaa
aacatagaacctatagtacatggtggtgggcaagaatatgggctacgaagtggtacaatt
aatctaccaatggctatctctatggttagagctataaagaatgcagttgatcaaacaaaa
gagcttaatttacgtttaagcaattataaaaataaattactttcatttttagcagaatac
aaaaatgtatttatcaactctcctcaaaatgcatcacctcatattataaatataggattt
ccaggtgttaagggtgaggtacttgttaatgctttttccaaacaaaacgtaatggtttca
actacaagcgcttgttcttctaagatgaataaattgaatgaggttttacttgcaatggaa
attgcagagtcaaaaatagaaggtagtataagaatttctttaggggcacatacgactgaa
aacgatatattaagttttatgaatgcatttgaatctgtatataaggaaattaaggagctg
ttaaagtaa

DBGET integrated database retrieval system