KEGG   Staphylococcus epidermidis ATCC 12228: SE1397Help
Entry
SE1397            CDS       T00110                                 

Definition
glycerophosphoryl diester phosphodiesterase
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SE1397
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     SE1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1433262..1434008)
Genome map
AA seq 248 aa AA seqDB search
MKFRRPNQHFQIVAHRGLPEDYPENTIIAYRHALMLHIDMLEIDVHYTKDKELVVIHDDT
IDRTSNGKGKVSDFTLKELKALDFGFYKGEKFKGESIPTFDEVLDLADNFSQKLLIEIKK
PSQYPNIENMIVDKLKERQISKSKVILQSFDFDCVKKLSAMNLDYELGLLISKKKYWHKL
PNFKKIAKVADYANPNYQIVSKKFMQLAHEEELKVLPYTVNKLKESQKLIDIGVDGIISD
VPEDLFEL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcgacgtccaaatcaacatttccaaatcgtagcgcatagaggattacctgaa
gattatcctgaaaatactattatcgcttatcgacatgcgctcatgttacatatagatatg
ttggaaattgatgtacattacacaaaagataaagaacttgtcgttatacatgatgatact
atcgatcgtacgtcaaatggtaaaggtaaggtttctgattttactttaaaagaattaaaa
gcgttagattttggtttctataaaggagagaaatttaaaggggagagtataccgactttt
gatgaagtgttagatttagcagataacttttcacaaaaattattaatagaaataaaaaag
cctagtcagtatccaaatattgaaaatatgattgttgataaattgaaggaaagacaaata
tctaaatctaaagtgattttacaatcattcgattttgattgtgtaaaaaaattgtcagca
atgaatttagattatgaattaggtttattaattagtaagaaaaaatattggcacaagtta
ccaaatttcaaaaaaattgccaaagttgctgattatgctaatcctaattatcaaattgtt
tcgaagaaatttatgcaacttgctcatgaggaagagttaaaagtattaccttatactgta
aataaattaaaagaatcacaaaaattaatagatattggtgttgacggtattatttccgat
gtacctgaagatttatttgagctataa

DBGET integrated database retrieval system