KEGG   Staphylococcus epidermidis ATCC 12228: SE1409Help
Entry
SE1409            CDS       T00110                                 

Definition
catabolite control protein A
Orthology
K02529  
LacI family transcriptional regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Transcription factors [BR:sep03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    SE1409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1447466..1448410)
Genome map
AA seq 314 aa AA seqDB search
MATVSRVVNGNQNVKPETRNKVNEVIKRLNYRPNAVARGLASKRTTTVGVIIPDISNVYY
SQLARGLEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGIIFLGGTISEEIKSLI
NQSSVPVVVSGTDGKDDHIASVNIDFKQAAEEATQYLIEKGAKTFSLIGGEYSIKAQDDV
LEGLKNVLSQHQLKLDDTLHLTGNESYKSGIKTFEQLQSNLPDAVLCISDEQAIGILHSA
QDAGVKVPEDLQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMRLLTKYMNDEEIENPN
VILPHRIEYRGTTQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtttcacgtgtagtaaatggaaaccaaaatgttaaaccagaaacacgtaat
aaagtaaatgaagtcattaaaaggttaaactatcgacctaacgcagttgcaagaggtctt
gcaagtaaacgtacaacgacagttggagttataattcccgatatttcaaatgtttattat
tctcaacttgcaagaggtttagaagatattgcaacaatgtacaaatatcactcaattatc
tcaaactcagataatgatccagaaaaagaaaaagaaatttttaataatttattaagtaaa
caagtcgatggtattattttcttaggtggaactatttctgaagaaattaaaagtcttatt
aatcaatcatctgtaccagtcgtagtttctggaacggatggtaaggatgatcatattgca
tctgtaaatattgattttaaacaagcagccgaagaagcaacacaatatcttatagagaag
ggtgctaaaacattttctttaataggtggagaatactctataaaggcacaagatgatgtt
ttagagggccttaaaaatgttttaagtcagcatcaactaaaattagacgatacattacat
ttaactggcaatgaaagttacaaatcaggtataaaaacatttgaacaattgcaatcgaat
ttaccagatgctgttctttgtattagtgatgagcaagcaataggtatattgcatagtgca
caagatgctggagtgaaagtacctgaagacttacagattattagttttaacaatacacgt
ttagtagaaatggtgagaccacagttatctagtgttattcaaccattgtatgatattggt
gctgttggaatgagattactgactaaatacatgaacgatgaagaaattgaaaatcctaat
gtcatattgcctcatagaatagaataccgtgggacaactcagtaa

DBGET integrated database retrieval system