KEGG   Staphylococcus epidermidis ATCC 12228: SE1417Help
Entry
SE1417            CDS       T00110                                 

Definition
thioredoxin-like protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1458579..1458890)
Genome map
AA seq 103 aa AA seqDB search
MIKLESEQQFEELKKGYTVFEFTAGWCPDCKVIEPDLPKLEKKYSQLQFVSVDRDQFIDI
CVQNDILGIPSFLIFKEGQLLGSYIGKERKSIDQIDQFLSQHI
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacttgaatcagaacaacaatttgaagaattaaaaaaagggtatacagtattt
gaattcactgctggatggtgtccagattgtaaagtaattgaaccggatttacctaaatta
gagaaaaaatacagtcaattacaatttgtgtctgtagatagagatcaatttatagatatt
tgtgttcaaaatgatattttaggcattcctagttttcttatctttaaagaaggtcaactt
ttaggaagctatataggtaaagagagaaaatcaattgatcaaattgatcaatttttatct
caacacatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system