KEGG   Staphylococcus epidermidis ATCC 12228: SE1433Help
Entry
SE1433            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K07139  
 
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1485501..1486454
Genome map
AA seq 317 aa AA seqDB search
MGNYFPYAFEDKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGS
GDFAGNRAEPIEVQFKKIKERMHEKWSEGQYIAYFQAFTNTHAPVEVLKEKYEPVLKEDG
VVGLSIATRPDCLPDDVVEYLAELNQRTYLWVELGLQTVHQSTSDLINRAHDMQTYYDGV
TKLRKHNINVCTHIINGLPGENYDMMMETAKEVAQMDVQGIKIHLLHLLKGTPMVKQYEK
GMLEFMSQQDYTNLVCDQLEVLPPEMIVHRITGDGPIDLMVGPMWSVNKWEVLNEIDNEL
ARRNSYQGKMNKQSIQS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactatttcccgtatgcctttgaagataaacgctatcacacatggaactatcat
ttaaaaaacaagtttggtcagaaaatatttaaggtcgcattagacggaggttttgattgc
ccaaatagagatggtactgtagctcatggaggttgcacattttgttctgcagcaggaagc
ggtgactttgcaggtaatagagctgaaccaattgaagttcaattcaaaaaaataaaagaa
cgtatgcatgaaaaatggagtgaaggtcaatatattgcatactttcaggcgtttacaaat
acgcatgcacctgttgaagtactaaaagaaaaatatgaacctgtcttaaaagaagatggc
gtcgttggtttatcaatcgcgacaagacctgattgtttgcctgatgatgttgtagaatat
ttagctgaacttaatcagcgcacttacttatgggtagagttgggcctacaaactgtgcat
cagtcaacttccgatttaataaatcgtgctcatgatatgcaaacatactatgacggcgta
acaaaattacgcaaacataatataaatgtttgtacgcacataatcaacggcttaccaggt
gaaaattatgacatgatgatggagactgctaaagaagtcgctcagatggacgttcaaggt
attaaaattcatttattacacttgctaaaaggaacgcctatggttaaacaatatgaaaaa
ggtatgctcgagtttatgagtcaacaagattataccaatcttgtttgtgatcaacttgaa
gtattacccccagaaatgattgtgcacagaatcactggagatggacctatagatctaatg
gttggaccaatgtggagtgttaataaatgggaagtattaaatgaaattgataatgagctt
gctagacgaaactcctatcaaggtaaaatgaacaagcagagtatacaatcatga

DBGET integrated database retrieval system