KEGG   Staphylococcus epidermidis ATCC 12228: SE1435Help
Entry
SE1435            CDS       T00110                                 

Definition
(RefSeq) repressor of toxins Rot
  KO
K20338  
MarR family transcriptional regulator, global regulator for virulence
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:sep00001]
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    SE1435
Transcription factors [BR:sep03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    SE1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1487251..1487550)
Genome map
AA seq 99 aa AA seqDB search
MSKEEILILLTLLEKGSMTLKEMDKYVHIKPYKRTRTYNNLVNLEWIYKERPQDDERTVI
IHFNDKQNSKKEDLLKFIDDSIKIKSEPMQSSLQSILAV
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaggaaattttgattttacttacacttttggaaaaaggctcaatgacttta
aaggaaatggataaatatgttcatattaaaccgtataaacgtacacgtacttataataat
ttagttaatcttgagtggatttacaaagaaagacctcaagatgatgaacgtacagttatt
attcattttaatgacaagcaaaattctaaaaaagaagatttgttaaagtttattgatgac
tcaattaaaatcaagtctgaaccaatgcaatctagtttacaatctattttagcagtttaa

DBGET integrated database retrieval system