KEGG   Staphylococcus epidermidis ATCC 12228: SE1441Help
Entry
SE1441            CDS       T00110                                 

Definition
(RefSeq) riboflavin specific deaminase
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00740  Riboflavin metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep02024  Quorum sensing
Module
sep_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SE1441
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SE1441
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     SE1441
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     SE1441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam
Motif
Other DBs
NCBI-GeneID: 1056617
NCBI-ProteinID: NP_764996
UniProt: A0A0H2VH53
Position
complement(1492777..1493820)
Genome map
AA seq 347 aa AA seqDB search
MSRFMDDAIQLAKMVNGQTGVNPPVGSVVVKNGRIVGLGAHLKKGDKHAEVQAIEMAGLN
TQGATIYVSLEPCTHHGSTPPCVHKIIEAGISKVIYAVKDTTLVSKGDEILREAGIEVEF
QYNENAAALYRDFFTAKRNEVPEVTVKVSSSLDGKQATDFNESKWITNKEVKEDVYQLRH
EHDAVITGRRTIEADNPLYTTRVPDGKHPIRVILSKKGQLDFNQQIFKDTASEIWIYTEN
EKLKTNKSFIKIISISNCDTTTILQDLYQRGIGKLLVEAGPNITSQFLQSKHLNELILYI
APKLIGGSGKHQFYKTDEVIDLPEATQFEIVDSKLINQNLKLKLRKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagatttatggatgatgctattcaactagcaaaaatggtaaatggacaaacaggt
gttaatccaccagtaggatccgttgttgttaaaaacggtaggattgtaggtttaggtgca
catttaaaaaagggagataaacatgccgaagtacaagctattgaaatggcaggtttaaat
acccaaggtgctaccatatacgtttcattagaaccttgcacacaccatggttcaacacca
ccttgtgtgcataaaatcattgaagcgggcatatctaaggtcatctatgctgttaaagat
actactttagtaagtaagggtgacgagattctgagagaagctggtatagaggttgaattt
caatataatgaaaatgcagctgcattataccgtgacttttttactgctaaaagaaacgaa
gttccagaagtaactgtaaaggtctcatctagtctagatggtaaacaagcaacagacttt
aatgaaagtaagtggataacaaacaaagaagttaaagaagatgtttatcaattaagacat
gagcatgatgcagttattactgggcgtagaaccattgaagcagacaatccattgtataca
accagggttcctgatggaaagcatccgattcgagttattctttctaagaaaggtcaactc
gattttaatcaacaaatatttaaagatactgcatcggagatatggatttacactgaaaat
gaaaaattaaaaacaaataaaagttttattaaaataataagtattagtaattgtgataca
acgacaatattacaagacttatatcaaagaggtattgggaaactgctagtcgaggcaggc
ccaaatattacatctcaatttctccaatccaaacatctaaatgaactcattttatatata
gccccgaaattaattggtggttctggcaaacatcaattttataagactgacgaggtcatt
gatttgcctgaagcaactcaatttgaaattgttgattccaagttaattaatcaaaattta
aaattgaaattacgaaagaagtga

DBGET integrated database retrieval system