KEGG   Staphylococcus epidermidis ATCC 12228: SE1441Help
Entry
SE1441            CDS       T00110                                 

Definition
riboflavin specific deaminase
Orthology
K11752  
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:sep00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1492777..1493820)
Genome map
AA seq 347 aa AA seqDB search
MSRFMDDAIQLAKMVNGQTGVNPPVGSVVVKNGRIVGLGAHLKKGDKHAEVQAIEMAGLN
TQGATIYVSLEPCTHHGSTPPCVHKIIEAGISKVIYAVKDTTLVSKGDEILREAGIEVEF
QYNENAAALYRDFFTAKRNEVPEVTVKVSSSLDGKQATDFNESKWITNKEVKEDVYQLRH
EHDAVITGRRTIEADNPLYTTRVPDGKHPIRVILSKKGQLDFNQQIFKDTASEIWIYTEN
EKLKTNKSFIKIISISNCDTTTILQDLYQRGIGKLLVEAGPNITSQFLQSKHLNELILYI
APKLIGGSGKHQFYKTDEVIDLPEATQFEIVDSKLINQNLKLKLRKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagatttatggatgatgctattcaactagcaaaaatggtaaatggacaaacaggt
gttaatccaccagtaggatccgttgttgttaaaaacggtaggattgtaggtttaggtgca
catttaaaaaagggagataaacatgccgaagtacaagctattgaaatggcaggtttaaat
acccaaggtgctaccatatacgtttcattagaaccttgcacacaccatggttcaacacca
ccttgtgtgcataaaatcattgaagcgggcatatctaaggtcatctatgctgttaaagat
actactttagtaagtaagggtgacgagattctgagagaagctggtatagaggttgaattt
caatataatgaaaatgcagctgcattataccgtgacttttttactgctaaaagaaacgaa
gttccagaagtaactgtaaaggtctcatctagtctagatggtaaacaagcaacagacttt
aatgaaagtaagtggataacaaacaaagaagttaaagaagatgtttatcaattaagacat
gagcatgatgcagttattactgggcgtagaaccattgaagcagacaatccattgtataca
accagggttcctgatggaaagcatccgattcgagttattctttctaagaaaggtcaactc
gattttaatcaacaaatatttaaagatactgcatcggagatatggatttacactgaaaat
gaaaaattaaaaacaaataaaagttttattaaaataataagtattagtaattgtgataca
acgacaatattacaagacttatatcaaagaggtattgggaaactgctagtcgaggcaggc
ccaaatattacatctcaatttctccaatccaaacatctaaatgaactcattttatatata
gccccgaaattaattggtggttctggcaaacatcaattttataagactgacgaggtcatt
gatttgcctgaagcaactcaatttgaaattgttgattccaagttaattaatcaaaattta
aaattgaaattacgaaagaagtga

DBGET integrated database retrieval system