KEGG   Staphylococcus epidermidis ATCC 12228: SE1472Help
Entry
SE1472            CDS       T00110                                 

Definition
integrase
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518948..1519442
Genome map
AA seq 164 aa AA seqDB search
MSIENFVNLKKYVSDPPIQSYVFVYILIVTGGRFGEVQKLSRSDLDYKNNTIHLPGTKTE
TSDRTVDIPAADMNMLRKTLSKMPVSLSNQLFSTGVGLITHNAVSKVLQKFCLENKIGKY
TLHSIRHTHCSYLLHNDVSIYYTSKRLGYKNIKNTMDAYFASIR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagaaaattttgtaaatttaaagaagtatgtatctgatccccctattcaatca
tatgtatttgtttatattttaatcgtcactggaggtcgctttggagaagttcaaaaacta
agtagaagtgatttagattataaaaataatacaatacacttaccaggaacgaaaacagaa
acttcagatagaactgtagatatacctgctgcagatatgaatatgttaagaaaaacatta
tctaaaatgccagtgagtttatcaaatcaattattcagtacaggtgtaggattgattaca
cacaatgctgtatctaaagtgttacaaaaattttgtttagaaaataaaataggtaaatat
actttgcatagtataagacacacgcattgttcttatttactacacaacgacgtatctatc
tattacacttcaaagagattaggttacaaaaatattaaaaatactatggatgcatatttc
gcatctattagatga

DBGET integrated database retrieval system