KEGG   Staphylococcus epidermidis ATCC 12228: SE1517Help
Entry
SE1517            CDS       T00110                                 

Definition
ABC transporter ecsA-like protein
Orthology
K01990  
ABC-2 type transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
ABC-2 type transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1566649..1567389)
Genome map
AA seq 246 aa AA seqDB search
MTVKVEHLTGGYGKKPVIKDLNFELEKGEIVGLIGLNGAGKSTTIKHMLGLINPMEGKLS
ISNIKINEDIENYRRKLSYIPESPVIYDELTLEEHIEMTAMAYQLSREEAMRRAKPLLKV
FRLENELKVFPSHFSKGMKQKVMIICAFIVDPELYIIDEPFLGLDPLGIQSMLDLMVEKR
NENRTVLMSTHILATAERYCDRFIILDKGEIVAFGNLDELREQTGLKDKTLDDIYIHVTQ
GSSAYE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaaagttgaacatcttacagggggatatggaaaaaaacctgtaattaaagat
ttgaattttgaattagaaaaaggtgaaattgtaggtttaataggtctaaatggtgctggg
aaaagtactacaattaaacatatgctaggattgattaatccaatggaaggcaaattatca
atttcaaatattaaaattaatgaagatattgaaaattatagaagaaagttatcttatata
cctgaatcaccagtcatctatgatgaactaactttagaggagcacattgaaatgacggcg
atggcttatcaattaagtagagaagaggctatgcgtagagctaaaccattgcttaaagtt
tttcgattagaaaatgaacttaaagtatttccaagtcatttttctaaagggatgaaacaa
aaagtgatgattatttgtgcatttatagttgatccagaattatatattattgacgaacct
ttcctcggtttagatcctttggggatacagtctatgttagatttaatggtagaaaaaaga
aatgaaaatcgaacagtattaatgagtacacatattttggctacagccgaaaggtattgt
gatagatttattattttagataaaggtgaaattgttgcatttggtaatcttgatgagtta
cgggaacaaacaggattaaaagataaaactttagatgatatttacatccatgtcacacaa
ggtagtagtgcttatgaataa

DBGET integrated database retrieval system