KEGG   Staphylococcus epidermidis ATCC 12228: SE1540Help
Entry
SE1540            CDS       T00110                                 

Definition
glutamate ABC transporter ATP-binding protein
Orthology
K02028  
polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Putative polar amino acid transport system
Brite
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.21  polar-amino-acid-transporting ATPase
     SE1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1587161..1587889)
Genome map
AA seq 242 aa AA seqDB search
MPVINIKNLNKKFGANEVLRDINLTVEKGEVVAIIGPSGSGKSTLLRCMNLLDVPSKGKV
IFEDNELTQHNVHLDNLRQKMGMVFQNFNLFPHKKVIENVMLAPLLLHKDSKDQLKEKAL
YLLEKVGLKDKADSYPNQLSGGQKQRVAIARALAMEPDVMLFDEPTSALDPEVVGDVLKV
MRQLANEGMTMVIVTHEMNFAKEISDKVVFMADGVVVESGTPQNIFENPQHSRTENFLSR
VL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgccagtgattaatattaaaaatttaaataaaaaatttggagcaaatgaagtattgaga
gatattaatcttactgttgaaaagggtgaagtggttgcaataattggaccatctggaagt
ggtaaaagcactttactccgttgtatgaatttgttagatgtaccttcaaaaggtaaagtt
atatttgaagataatgaattaactcaacataatgttcatttagataatttacgacaaaaa
atgggtatggtatttcaaaattttaatttatttcctcataaaaaggtcattgaaaatgta
atgttggcaccacttttattacataaagatagtaaagatcaattaaaagagaaagcttta
tatttacttgaaaaagtggggcttaaagacaaagcagattcatatcctaatcaactgtct
ggaggtcaaaaacaaagagttgctattgcaagagctttggcaatggaacctgatgttatg
ttatttgatgaaccaacatctgcacttgatcctgaagtagtaggggatgttttaaaagta
atgagacaattagcgaatgaaggtatgacaatggtgattgtcacgcatgagatgaacttt
gctaaagaaataagtgataaagtagtatttatggccgatggtgttgtggttgaatctggt
acaccacaaaacatatttgaaaatcctcagcacagtcgaactgaaaattttttatcacga
gtgttataa

DBGET integrated database retrieval system