KEGG   Staphylococcus epidermidis ATCC 12228: SE1541Help
Entry
SE1541            CDS       T00110                                 

Definition
glutamine-binding periplasmic protein
Orthology
K02029  
polar amino acid transport system permease protein
K02030  
polar amino acid transport system substrate-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Putative polar amino acid transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1587876..1589333)
Genome map
AA seq 485 aa AA seqDB search
MKCLFKMLSIIIIMLSTFTLFISPSTYANEDENWTKIKNRGELRVGLSADYAPLEFEKTI
HGKTEYAGVDIELAKKIAKDNHLKLKIVNMQFDSLLGALKTGKIDIIISGMTTTPERKKE
VDFTKPYMITNNVMMIKKDDAKRYQNIKDFEGKTIAAQKGTDQEKIAQTEIEDSKISSLN
RLPEAILSLKSGKVAGVVVEKPVGEAYLKQNSELTFSKIKFNEEKKQTCIAVPKNSPVLL
DKLNQTIDNVKEKNLIDQYMTKAAEDMQDDGNFISKYGSFFIKGIKNTILISLVGVVLGS
ILGSFIALLKISKIRPLQWIASIYIEFLRGTPMLVQVFIVFFGTTAALGLDISALICGTI
ALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNYRQTMQSVVMPQAIKKILPALGNEF
VTLIKESSIVSTIGVSEIMFNAQVVQGISFDPFTPLLVAALLYFLLTFALTRVMNFIEGR
MSASD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttgttcaaaatgctatcaatcataataataatgttaagtactttcacctta
ttcatcagtccgagtacatatgcaaatgaagatgaaaattggactaaaataaaaaatcga
ggagaactaagagttggattgtcagctgattatgcacctttagaatttgaaaagacgata
catggtaaaactgaatatgcgggtgtagatatagaattagctaaaaagattgcgaaagat
aatcatctaaagctaaaaattgtaaacatgcaatttgatagcttattaggtgcacttaag
accggtaaaatcgatattattatctccggtatgacaacaactcccgaacgaaaaaaagaa
gtggattttacaaaaccttacatgattacaaataatgtgatgatgattaaaaaagatgat
gcaaaacgttatcaaaacatcaaagattttgaaggcaaaacaattgctgcgcaaaaaggg
acagatcaagaaaaaattgcacaaactgagattgaagatagtaaaatttcttcactcaat
agattacctgaagctatattatctttaaaaagtggaaaagtagcaggtgtagttgttgaa
aaaccagtaggtgaggcatatttaaaacaaaattcagaactaacattttcaaagattaaa
tttaatgaagaaaagaaacaaacatgtatagctgttcctaagaactctcctgtactttta
gataagctaaatcaaacgattgataatgtaaaagaaaaaaatttaattgatcaatacatg
acaaaagcagccgaagatatgcaagatgatggaaattttatttctaaatatggcagtttt
ttcattaaaggaattaaaaatactattttgatttcattagtaggtgtggtattggggtct
attttaggctcttttatagctttattaaaaataagtaaaattagaccattacaatggata
gcaagtatatacatagaatttttaagaggtactcctatgcttgtgcaagtgtttattgta
ttttttgggactactgcagctttggggttagatatttcagctttaatttgtggtactatt
gcgcttgttataaattcttcagcctacattgccgagattattagagctggtattaatgct
gtagataaaggacaaactgaagctgctagaagtttaggattgaattatagacagactatg
caatcagtagttatgccacaggcaattaagaaaattttacctgcattaggtaatgaattt
gtaaccttgattaaagaatcgtctatagtttccacaattggagtgagtgaaatcatgttt
aatgcacaagttgtacaagggatatcttttgatcctttcacaccattgttagttgcagca
ttactatatttcttacttacatttgcacttacacgtgttatgaattttattgaagggaga
atgagtgccagtgattaa

DBGET integrated database retrieval system