KEGG   Staphylococcus epidermidis ATCC 12228: SE1541Help
Entry
SE1541            CDS       T00110                                 

Definition
(RefSeq) glutamine-binding periplasmic protein
  KO
K02029  polar amino acid transport system permease protein
K02030  polar amino acid transport system substrate-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
sep_M00236  Putative polar amino acid transport system
Brite
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    SE1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 BPD_transp_1 Lig_chan-Glu_bd Cortex-I_coil NMT1 DUF4085
Motif
Other DBs
NCBI-GeneID: 1056793
NCBI-ProteinID: NP_765096
UniProt: A0A0H2VH13
Position
complement(1587876..1589333)
Genome map
AA seq 485 aa AA seqDB search
MKCLFKMLSIIIIMLSTFTLFISPSTYANEDENWTKIKNRGELRVGLSADYAPLEFEKTI
HGKTEYAGVDIELAKKIAKDNHLKLKIVNMQFDSLLGALKTGKIDIIISGMTTTPERKKE
VDFTKPYMITNNVMMIKKDDAKRYQNIKDFEGKTIAAQKGTDQEKIAQTEIEDSKISSLN
RLPEAILSLKSGKVAGVVVEKPVGEAYLKQNSELTFSKIKFNEEKKQTCIAVPKNSPVLL
DKLNQTIDNVKEKNLIDQYMTKAAEDMQDDGNFISKYGSFFIKGIKNTILISLVGVVLGS
ILGSFIALLKISKIRPLQWIASIYIEFLRGTPMLVQVFIVFFGTTAALGLDISALICGTI
ALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNYRQTMQSVVMPQAIKKILPALGNEF
VTLIKESSIVSTIGVSEIMFNAQVVQGISFDPFTPLLVAALLYFLLTFALTRVMNFIEGR
MSASD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttgttcaaaatgctatcaatcataataataatgttaagtactttcacctta
ttcatcagtccgagtacatatgcaaatgaagatgaaaattggactaaaataaaaaatcga
ggagaactaagagttggattgtcagctgattatgcacctttagaatttgaaaagacgata
catggtaaaactgaatatgcgggtgtagatatagaattagctaaaaagattgcgaaagat
aatcatctaaagctaaaaattgtaaacatgcaatttgatagcttattaggtgcacttaag
accggtaaaatcgatattattatctccggtatgacaacaactcccgaacgaaaaaaagaa
gtggattttacaaaaccttacatgattacaaataatgtgatgatgattaaaaaagatgat
gcaaaacgttatcaaaacatcaaagattttgaaggcaaaacaattgctgcgcaaaaaggg
acagatcaagaaaaaattgcacaaactgagattgaagatagtaaaatttcttcactcaat
agattacctgaagctatattatctttaaaaagtggaaaagtagcaggtgtagttgttgaa
aaaccagtaggtgaggcatatttaaaacaaaattcagaactaacattttcaaagattaaa
tttaatgaagaaaagaaacaaacatgtatagctgttcctaagaactctcctgtactttta
gataagctaaatcaaacgattgataatgtaaaagaaaaaaatttaattgatcaatacatg
acaaaagcagccgaagatatgcaagatgatggaaattttatttctaaatatggcagtttt
ttcattaaaggaattaaaaatactattttgatttcattagtaggtgtggtattggggtct
attttaggctcttttatagctttattaaaaataagtaaaattagaccattacaatggata
gcaagtatatacatagaatttttaagaggtactcctatgcttgtgcaagtgtttattgta
ttttttgggactactgcagctttggggttagatatttcagctttaatttgtggtactatt
gcgcttgttataaattcttcagcctacattgccgagattattagagctggtattaatgct
gtagataaaggacaaactgaagctgctagaagtttaggattgaattatagacagactatg
caatcagtagttatgccacaggcaattaagaaaattttacctgcattaggtaatgaattt
gtaaccttgattaaagaatcgtctatagtttccacaattggagtgagtgaaatcatgttt
aatgcacaagttgtacaagggatatcttttgatcctttcacaccattgttagttgcagca
ttactatatttcttacttacatttgcacttacacgtgttatgaattttattgaagggaga
atgagtgccagtgattaa

DBGET integrated database retrieval system