KEGG   Staphylococcus epidermidis ATCC 12228: SE1581Help
Entry
SE1581            CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1632904..1633452)
Genome map
AA seq 182 aa AA seqDB search
MNVHKIDLSGNKFQIQRFVLLQIVLALFTILFTYKWAYQTTHIIEQNLVMNLIFGFVGFA
VLVILHEFIHRILFIIFSKGEKPSLKYDKNKIIVQFSQTCFHRWQFTIIMIAPLVIISAT
LLALIQIYSFSSLIFMFSIHTSYCMIDVFLVALALQSKFKYIQTYGEGLYLYHQKPTQTY
YE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtgcataaaatagatttatcaggcaacaaatttcaaatccaacgatttgttctg
ttgcaaattgtattggcgctatttacaatactatttacttataaatgggcttatcaaaca
acgcatatcattgaacaaaatcttgtcatgaatcttatttttggatttgtaggtttcgca
gtactagttattttgcatgagtttattcatcgtattttgttcattatattttctaaaggt
gaaaaaccatctttaaaatatgataaaaacaaaattattgtacagttctctcagacttgt
tttcatcggtggcaatttacaattatcatgatagcaccacttgttatcataagtgcgacc
ttactagcacttattcaaatatattccttctcatctttaatctttatgtttagtatacat
acaagttattgtatgatagatgtgtttttagtagcattggcattacaaagcaaattcaaa
tatatacaaacctatggagaaggtttgtatctttatcatcaaaagcctactcaaacctat
tatgaataa

DBGET integrated database retrieval system