KEGG   Staphylococcus epidermidis ATCC 12228: SE1602Help
Entry
SE1602            CDS       T00110                                 

Definition
manganese-dependent inorganic pyrophosphatase (EC:3.6.1.1)
Orthology
K15986  
manganese-dependent inorganic pyrophosphatase [EC:3.6.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SE1602
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     SE1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1657801..1658730
Genome map
AA seq 309 aa AA seqDB search
MTKTFIFGHKNPDTDAISSALIMADFEQQTGNTEAKAYRLGEISAETQFALDYFNVEAPE
LLNEDLKGQDVILVDHNEFQQSADTISNATIKHVIDHHRISNFETAGPLYYRAEPVGCSA
TILYKMYKERGFEIKPEIAGLMISAIISDSLLFKSPTCTKEDVDAAQALKDIANVDLEAY
GLEMLKAGASTTDKSAETLVNMDAKSFNMGDYVTRIAQVNTVDIDEVLDRKEEFEKVMLE
MSANEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFKVQLDDGMAFLSGVVSRKKQVV
PQITEVLTQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacttttattttcgggcacaaaaatccagatactgatgctatttcttcagct
ttaattatggctgattttgagcaacaaactggtaatactgaagcaaaagcttatcgttta
ggtgaaataagtgcggaaactcaatttgcactagattattttaacgtagaagctccagaa
ttattaaacgaagatttaaaaggacaagatgttattttagtcgaccataacgagtttcaa
caaagtgcagatactatttcaaacgctacaattaaacatgtgatagatcatcacagaatt
tctaactttgaaacagctggccctttatactatagagcagaaccagttggttgtagtgca
acaattttatataaaatgtataaagaacgtggatttgaaattaaaccagaaatcgctgga
cttatgatttcagctataatttctgatagtttattatttaaatcacctacctgcacaaaa
gaagatgtagatgctgctcaagcacttaaagatattgcaaatgttgatttagaagcatat
ggtttagaaatgttaaaagcaggtgcttcaactacagataaatctgctgaaacacttgtc
aatatggatgctaaatcattcaatatgggagattatgtaacacgtattgctcaagtcaat
actgtagatattgatgaagttttagatcgtaaagaggaatttgaaaaagttatgttagaa
atgagtgccaatgaaaaatacgatttattcgttcttgtagttactgatattattaacagc
gattctaaaatccttgtagttggtgctgaaaaagataaagttggagaagcatttaaagta
caactagatgatggtatggctttcttatctggcgttgtatcacgaaaaaaacaagttgtt
cctcaaatcactgaagttttaactcaataa

DBGET integrated database retrieval system