KEGG   Staphylococcus epidermidis ATCC 12228: SE1606Help
Entry
SE1606            CDS       T00110                                 

Definition
penicillinase repressor
Orthology
K02171  
BlaI family transcriptional regulator, penicillinase repressor
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
Module
beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SE1606
Transcription factors [BR:sep03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SE1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1661974..1662354)
Genome map
AA seq 126 aa AA seqDB search
MANKQVEISMAEWDVMNIIWNKKSVSANEIVVEIQKNKEVSDKTIRTLITRLYKKEIIKR
YKYNNIYFYSSIIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDIL
NDISKK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccaataagcaagttgaaatatctatggctgaatgggatgttatgaatataatatgg
aataaaaaatcagtatcagctaatgaaattgtagttgagattcaaaaaaataaagaagtt
agcgataagacgattagaacattaattacaagactatataaaaaagagattataaaacga
tataaatataataatatttatttttactcatcaattattaaagaagatgatattaaaatg
aaaactgctaaaacctttcttaataaattgtatggaggggatatgaaaagtttagtgctt
aattttgcgaaaaatgaagaattaaataacaaagaaattgaagaattgcgagacatttta
aatgatattagtaaaaaataa

DBGET integrated database retrieval system