KEGG   Staphylococcus epidermidis ATCC 12228: SE1607Help
Entry
SE1607            CDS       T00110                                 

Definition
bla regulator protein blaR1
Orthology
K02172  
bla regulator protein blaR1
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
Module
beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SE1607
Peptidases [BR:sep01002]
 Metallo Peptidases
  Family M56
   SE1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1662344..1664101)
Genome map
AA seq 585 aa AA seqDB search
MAKLLIMSIVSFCFIFLLLLFFRYILKRYFNYMLNYKVWYLTLLAGLIPFIPIKFSFFKF
NNLNNQEPTVESNSHNLNPNINTTKPVHEFTTDIYKFNWDSIDNICTVIWIVLVIILSFK
FLNSLLYLKYLKKQLLYLNEKEKDKINKILFNHQYKRNIVIRKAESIHSPITFWYGKYII
LIPSLYFKSINDKKLKYIILHEYAHAKNRDTLHLIIFHIFSIAMSYNPLIQIVKRKMIHD
NEVEADRFVLNNINKNEFKSYAEAIMDSVLKTSFFNKNILSHSFNGKKSLLKRRLINIKE
GNLKKQSKLILIFICIFTFFIMIIQSQFLMGQSLTDYNYKKPLQSDYQILDESKNFGSNS
GSFVMYSMKKDKYYIYNEKESRKRYSPDSTYKIYLALFGLDRHIISDKNSRMSWNHNHYP
FDSWNKDQDLNTAIQNSVNWYFERISNQLSKNYTSDQLKQLNYGNKNLGSYKAYWLEDSL
KISNLEQVIVLKNMMEQNNHFSKNEKKQLSSSLLIRKNENYELYGKTGTGIVNGKYNNGW
FVGYVITNHDKYYFSTHLSDEKASGENAKFINEKILKEMGVLNGQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttattaataatgagcatagtaagcttttgttttatatttttattgttatta
ttttttaggtacatattaaaacgctattttaattatatgttaaattataaagtttggtat
ctaactcttcttgcaggattaattcctttcatccctattaaattctctttttttaaattt
aataatttgaataatcaagagcccacagttgaaagtaattcacacaatttgaatcctaac
ataaataccactaaacctgttcatgagtttacaacagacatctataagtttaattgggat
tcaatagataatatctgcacagttatttggatagttttagttattattttaagttttaaa
tttttaaattctttattatatcttaagtatttaaagaaacagttactttatctaaatgaa
aaagaaaaagataaaataaacaagatacttttcaatcatcaatataaaagaaatattgtg
attcgaaaagcagaatctattcattctccaataactttttggtatggaaaatatattatt
ttgattcccagtttatattttaaaagtataaatgacaaaaaactaaaatatataatattg
cacgagtatgctcatgctaaaaacagagatactttgcatttaattatctttcatattttt
tctattgctatgagttataatccactaatacaaattgtaaaaagaaagatgattcatgac
aatgaagtagaagccgatagatttgtccttaataatattaacaaaaatgaatttaagtct
tatgcggaagctattatggattccgtattaaaaacctcatttttcaacaaaaatatatta
agccattcatttaatggtaaaaaatcattactcaaaagaagattaattaatataaaagaa
ggcaatctgaagaagcagtcaaaattaattctaatttttatttgtatttttacttttttt
atcatgataattcaaagccagtttttaatggggcaatccttaactgattataattataaa
aagcccttacaaagcgattaccaaattttagatgaaagtaaaaattttggttcaaatagt
ggatctttcgttatgtacagcatgaagaaagacaaatactatatttataatgaaaaagaa
agtagaaaaagatattctcctgattcaacttacaaaatttatttagcactgtttggactt
gaccgtcatattataagtgacaaaaattcacgtatgtcatggaatcataatcattatcct
ttcgattcttggaataaggatcaagatttaaatacggcaatacaaaactcagttaattgg
tacttcgaacgtattagtaatcaattatcaaagaattatacttctgatcaactcaagcaa
ttaaattatggtaataaaaatttgggaagttataaagcctattggttggaagatagtttg
aaaatatctaatcttgaacaagtaatagttttaaaaaatatgatggaacaaaataaccat
tttagtaaaaatgaaaagaaacaattatcttcttcgttattgattagaaaaaatgaaaat
tatgaattgtatgggaaaacaggtacaggtatagtaaacgggaaatataataatgggtgg
tttgtaggttacgtaattacaaatcatgataagtattatttttctacacatttatcagat
gaaaaagcctctggtgaaaatgctaaattcataaatgaaaaaatattaaaagaaatgggt
gttttaaatggccaataa

DBGET integrated database retrieval system