KEGG   Staphylococcus epidermidis ATCC 12228: SE1648Help
Entry
SE1648            CDS       T00110                                 

Definition
(RefSeq) vga protein
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Translation factors [BR:sep03012]
 Eukaryotic Type
  Initiation factors
   Initiation associated factors
    SE1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_tran_Xtn SMC_N ABC_tran_CTD AAA MMR_HSR1 AAA_29 Roc RsgA_GTPase ATP-synt_ab AAA_18 AAA_30 AAA_22 NACHT NB-ARC ATPase_2 IstB_IS21 RNA_helicase AAA_16 cobW NTPase_1 AAA_33 Dynamin_N AAA_28 DLIC SRP54 RuvB_N AAA_14 TsaE AAA_24 DUF87 AAA_23 DASH_Hsk3 DUF5329 ArgK AAA_19
Motif
Other DBs
NCBI-GeneID: 1057275
NCBI-ProteinID: NP_765203
UniProt: A0A0H2VHI1
Position
1700928..1702862
Genome map
AA seq 644 aa AA seqDB search
MILLQLNDISKSFDGEDIFTDVNFEVKTGERIGVVGRNGAGKSTLMKIIAGVENYDSGRI
SKIKNLTMSYLTQQMTLNSEATVFEEMSKPFEHIKKIENLIKDETDWLARNGQDYESDEY
QSHIEKYETLTNRYEQLDGYQYESKIKTVLHGLNFTESDFNKPINDFSGGQKTRLSLAQM
LLKEPDLLLLDEPTNHLDMETTKWLEDYLKYFKGAIVIISHDRYFLDKIVTQVYDVALGN
VKHYVGNYEQFIKQRNQYYEKRMQEFEKQQEEIKRLETFVEKNITRASTSGMAKSRRKTL
EKMERIDKPMIDARSANIQFGFDRNTGNDVMHIHDLKIGYDSPITLPINLEIFKGDHIAI
IGPNGVGKTTLIKTIAEKQHKLGGQIIFGANLQIGYYDQKQAEFKSNKTILDYVWDQYPH
MNEKDVRAVLGRFLFVQEDVKKIINDLSGGEKARLQLALLMLQRDNVLILDEPTNHLDID
SKEMLEQALKDFEGTIIFVSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIEKTEEAAA
IKAHETITQNNFENKEINQDANTSTYISQKQQKRQQRKLERQIEHCERQIEELEAQISHI
DEQLTQPEVFNDPLKASKFANQKSDTEQKLEQIMLEWEKLQEKL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgatacttttacaacttaatgacatctccaaatcgttcgatggtgaagatatcttcaca
gatgttaattttgaggtgaaaactggcgaaagaatcggcgtagtaggccgtaatggagct
ggtaaatcgacattaatgaaaatcatagcaggtgtggaaaattacgatagtggtcgaata
tcaaaaatcaaaaatttgacaatgagttatttaactcagcaaatgacactcaattcagaa
gctactgtctttgaagaaatgtctaagccttttgaacatataaagaaaattgaaaattta
attaaggatgaaaccgattggcttgcacgaaatggacaagattatgaatccgatgaatat
caatcacatattgaaaaatatgaaactttaacgaatcgttatgagcaattagatggttat
caatatgagagtaaaattaaaacagtcctgcacgggcttaactttacagaaagcgatttc
aacaagcctattaatgattttagtggtggtcaaaaaacacgtctttctcttgctcaaatg
ttacttaaagaacccgatttactccttcttgatgaaccaactaaccatctagacatggaa
acaaccaagtggttagaggattacttaaagtactttaaaggggcaattgtaattatcagt
catgatagatattttttagataaaattgtaactcaagtttatgatgttgctctaggaaat
gtaaaacactatgtaggaaactatgagcaatttataaagcaacgtaatcagtattacgaa
aaacgcatgcaagaatttgaaaagcaacaagaagaaatcaagcgtttagaaacctttgta
gaaaaaaatattactcgtgcatctacaagcggcatggctaagagtagacgtaaaacattg
gaaaaaatggaacgtattgataaacctatgatagatgctagaagtgcaaatatacaattt
ggcttcgaccgtaatactggtaatgatgtgatgcacattcatgatttaaaaattggttac
gactcacctattacactacctataaacctcgaaatctttaaaggggatcatatagctatc
attggtccaaatggtgttggtaaaacaacattgataaaaacaattgctgaaaaacaacat
aaactaggtggtcaaattatctttggtgctaatttacaaattggttactatgatcaaaaa
caagctgaatttaaatcaaataaaaccattctcgattatgtttgggatcaatatccacat
atgaatgaaaaagatgtacgggcagtattagggcgtttcttgttcgttcaagaagacgta
aaaaaaattatcaatgacttatccggcggcgaaaaggcacgattacaattagcactttta
atgttacaacgtgataatgttcttatcttagatgaaccgactaaccatttagatattgat
tctaaagaaatgcttgaacaagcattgaaagattttgaaggcacaattatttttgtatca
catgatcgttattttattaaccaacttgcaaataaagtttttgatttaaacattaatggt
ggccaaatgtatttgggagattatcagtattatattgagaaaactgaagaagctgcagct
atcaaagcacatgaaacaataactcaaaataattttgaaaataaagagataaatcaagac
gcaaatacttcaacctatatcagtcaaaagcaacaaaaaagacaacaacgtaaattagaa
agacaaattgaacattgtgaaagacaaatcgaagaattagaagcacaaatatcacatatc
gacgaacagttaacacaacctgaagtatttaacgaccctctaaaagctagtaaatttgcc
aatcaaaaatccgataccgaacaaaaattagaacaaataatgttggaatgggaaaaatta
caagaaaagctctaa

DBGET integrated database retrieval system