KEGG   Staphylococcus epidermidis ATCC 12228: SE1648Help
Entry
SE1648            CDS       T00110                                 

Definition
vga protein
Orthology
K06158  
ATP-binding cassette, subfamily F, member 3
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1700928..1702862
Genome map
AA seq 644 aa AA seqDB search
MILLQLNDISKSFDGEDIFTDVNFEVKTGERIGVVGRNGAGKSTLMKIIAGVENYDSGRI
SKIKNLTMSYLTQQMTLNSEATVFEEMSKPFEHIKKIENLIKDETDWLARNGQDYESDEY
QSHIEKYETLTNRYEQLDGYQYESKIKTVLHGLNFTESDFNKPINDFSGGQKTRLSLAQM
LLKEPDLLLLDEPTNHLDMETTKWLEDYLKYFKGAIVIISHDRYFLDKIVTQVYDVALGN
VKHYVGNYEQFIKQRNQYYEKRMQEFEKQQEEIKRLETFVEKNITRASTSGMAKSRRKTL
EKMERIDKPMIDARSANIQFGFDRNTGNDVMHIHDLKIGYDSPITLPINLEIFKGDHIAI
IGPNGVGKTTLIKTIAEKQHKLGGQIIFGANLQIGYYDQKQAEFKSNKTILDYVWDQYPH
MNEKDVRAVLGRFLFVQEDVKKIINDLSGGEKARLQLALLMLQRDNVLILDEPTNHLDID
SKEMLEQALKDFEGTIIFVSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIEKTEEAAA
IKAHETITQNNFENKEINQDANTSTYISQKQQKRQQRKLERQIEHCERQIEELEAQISHI
DEQLTQPEVFNDPLKASKFANQKSDTEQKLEQIMLEWEKLQEKL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgatacttttacaacttaatgacatctccaaatcgttcgatggtgaagatatcttcaca
gatgttaattttgaggtgaaaactggcgaaagaatcggcgtagtaggccgtaatggagct
ggtaaatcgacattaatgaaaatcatagcaggtgtggaaaattacgatagtggtcgaata
tcaaaaatcaaaaatttgacaatgagttatttaactcagcaaatgacactcaattcagaa
gctactgtctttgaagaaatgtctaagccttttgaacatataaagaaaattgaaaattta
attaaggatgaaaccgattggcttgcacgaaatggacaagattatgaatccgatgaatat
caatcacatattgaaaaatatgaaactttaacgaatcgttatgagcaattagatggttat
caatatgagagtaaaattaaaacagtcctgcacgggcttaactttacagaaagcgatttc
aacaagcctattaatgattttagtggtggtcaaaaaacacgtctttctcttgctcaaatg
ttacttaaagaacccgatttactccttcttgatgaaccaactaaccatctagacatggaa
acaaccaagtggttagaggattacttaaagtactttaaaggggcaattgtaattatcagt
catgatagatattttttagataaaattgtaactcaagtttatgatgttgctctaggaaat
gtaaaacactatgtaggaaactatgagcaatttataaagcaacgtaatcagtattacgaa
aaacgcatgcaagaatttgaaaagcaacaagaagaaatcaagcgtttagaaacctttgta
gaaaaaaatattactcgtgcatctacaagcggcatggctaagagtagacgtaaaacattg
gaaaaaatggaacgtattgataaacctatgatagatgctagaagtgcaaatatacaattt
ggcttcgaccgtaatactggtaatgatgtgatgcacattcatgatttaaaaattggttac
gactcacctattacactacctataaacctcgaaatctttaaaggggatcatatagctatc
attggtccaaatggtgttggtaaaacaacattgataaaaacaattgctgaaaaacaacat
aaactaggtggtcaaattatctttggtgctaatttacaaattggttactatgatcaaaaa
caagctgaatttaaatcaaataaaaccattctcgattatgtttgggatcaatatccacat
atgaatgaaaaagatgtacgggcagtattagggcgtttcttgttcgttcaagaagacgta
aaaaaaattatcaatgacttatccggcggcgaaaaggcacgattacaattagcactttta
atgttacaacgtgataatgttcttatcttagatgaaccgactaaccatttagatattgat
tctaaagaaatgcttgaacaagcattgaaagattttgaaggcacaattatttttgtatca
catgatcgttattttattaaccaacttgcaaataaagtttttgatttaaacattaatggt
ggccaaatgtatttgggagattatcagtattatattgagaaaactgaagaagctgcagct
atcaaagcacatgaaacaataactcaaaataattttgaaaataaagagataaatcaagac
gcaaatacttcaacctatatcagtcaaaagcaacaaaaaagacaacaacgtaaattagaa
agacaaattgaacattgtgaaagacaaatcgaagaattagaagcacaaatatcacatatc
gacgaacagttaacacaacctgaagtatttaacgaccctctaaaagctagtaaatttgcc
aatcaaaaatccgataccgaacaaaaattagaacaaataatgttggaatgggaaaaatta
caagaaaagctctaa

DBGET integrated database retrieval system