KEGG   Staphylococcus epidermidis ATCC 12228: SE1667Help
Entry
SE1667            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K06959  
uncharacterized protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1725343..1727493)
Genome map
AA seq 716 aa AA seqDB search
MDNSLIETIVSKYQFSEKQIKAVLKLLKENNTVPFIARYRKEATGGLDEVEIKQINDEYN
YMLNLQKRKEEVIHNIDQQGLLTSDLKQDILTQTKLQRVEDLYRPYKQKKKTRATEAKRK
GLEDLADWFSQSKLDTKIEDKAQLFLNDEVTTIEDAIEGAKDIIAERISDNPQYRSKILK
DVFNQGLIVSSKKKKAEDEKQTFSMYYDYKEPIKRIANHRVLAMNRGEKEKVLSIKIDFD
TTRIQREIANVEIKTQNEATPFIKEAIQDSLKRLILPSIEREIRGDLTQNAESHAIDVFS
ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVVNPFGTFIAKGVIYPHPPISKVEAAEKE
LVKMISDYNIELLAIGNGTASRETEQFVAQVIKKYQLQAQFIIVNEAGASVYSASEIARQ
EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKDLSSALTFVVETAV
NQVGVDVNTASKSLLQYVSGLTSTIAQNIIDYKEENGPIKHHKEISRIKRLGAKTFEQSI
GFLRIVDGEEPLDNTAIHPESYDVAYRMLHQLDLTAQDIGSVKLKNTLSNVNISTLVSQL
NIGEPTLKDIIQSLIAPNRDPRDEFETPILKSDVLSIEDLSKGMKLNGTVRNVVDFGAFV
DIGVKQDGLVHISKLSKKFVKNPMDMISVGDIVEVWILDIDENKGKVSLTMVAPNE
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggataacagtttaattgaaacaattgtaagtaaatatcaattttcggaaaaacaaatt
aaagcagttttaaaattgctgaaagaaaacaatacggttccatttatagcaagatatcgt
aaagaagctacaggtggacttgatgaagtagaaattaaacaaatcaatgatgaatataac
tatatgttaaatcttcaaaaacgtaaagaagaagtaatacataatattgatcaacagggt
ctattaacttctgatttaaagcaagacatattaacacagacgaagctacaaagagttgaa
gatttatatcgtccatataaacaaaaaaagaaaacacgtgcaactgaggctaaaagaaaa
ggattagaagatttagcagattggttttcacaatcaaaattggatacaaaaattgaagat
aaagctcaattattcttaaatgatgaagtgactacaattgaagatgcgatagaaggggct
aaagatattatagctgaacgtatttcggataatcctcaatatcgctctaaaatacttaaa
gatgtttttaatcagggactaattgtttcctcgaaaaagaaaaaagccgaagatgagaaa
caaacattttctatgtactatgattacaaggaaccaattaaacgtattgctaatcatcgt
gttttagcgatgaatcgaggagaaaaagaaaaagtattatcaataaaaattgattttgac
acgacacgtattcaaagagaaatagcaaatgttgagataaaaactcaaaatgaagcaact
ccgtttattaaagaggctattcaggatagccttaagcgattaattcttccttcaatagaa
agagaaattagaggagatttaacacaaaatgcagaatctcatgcaatagatgtattcagt
gaaaatcttagaaatttattactacaaccaccaatgaaaggtaaacaaattcttggagta
gatccagcatttagaacagggtgcaaacttgctgtcgtcaatccatttggtacctttatt
gctaaaggtgttatttatcctcatcctccaatatcaaaagttgaggcagccgaaaaagag
ctggtaaagatgataagtgactataatattgagcttttagcgattggtaacggtactgcg
agtagagaaactgaacaatttgttgctcaagtaataaaaaaatatcaacttcaagctcaa
tttatcatagtcaatgaagctggcgcatcagtttattcagcatcagaaattgctagacaa
gaatttccagattttcaagtagaagaacgaagtgcagtttcaattggtagaagagttcag
gatcctttaagcgaacttgttaaaatagatcctaaatctataggagtaggacagtaccaa
catgatgtcaaccaaaaagatttaagtagtgccttaacgtttgtagtagagactgccgtc
aatcaagttggtgtggatgtgaatactgcttctaaatccttgttacaatatgtatcaggt
cttacatcaactatcgctcaaaatattattgattataaggaagaaaacggacctataaaa
catcataaagaaataagtagaattaaacgattaggtgcaaaaacatttgagcaaagtatt
ggttttttaagaattgttgatggtgaagaacctttagataatactgcaatacaccctgaa
agttacgatgttgcatatcgcatgcttcatcaattagatttaactgcacaagatataggt
tccgttaaactcaaaaacacgttatcaaatgttaatatttcaacacttgtatctcaatta
aatattggtgaacctacattaaaagatataatacaatcattgattgcacctaatagagat
ccaagagatgaatttgaaacacctattttgaagtccgatgtattatcgattgaagattta
tctaaaggcatgaagttgaatggtacagtaagaaatgttgttgactttggagcatttgta
gatatcggtgttaaacaagacggactagtacacatatcaaaattatctaagaaattcgtt
aaaaatccaatggatatgataagtgtaggagatattgtagaagtttggattttagatata
gatgaaaataaaggcaaagtttcattgactatggttgccccaaatgaataa

DBGET integrated database retrieval system