KEGG   Staphylococcus epidermidis ATCC 12228: SE1667Help
Entry
SE1667            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
  KO
K06959  protein Tex
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tex_N Tex_YqgF HHH_3 S1 HHH_7 YqgF DLD Sigma54_CBD
Motif
Other DBs
NCBI-GeneID: 1056909
NCBI-ProteinID: NP_765222
UniProt: A0A0H2VJJ8
Position
complement(1725343..1727493)
Genome map
AA seq 716 aa AA seqDB search
MDNSLIETIVSKYQFSEKQIKAVLKLLKENNTVPFIARYRKEATGGLDEVEIKQINDEYN
YMLNLQKRKEEVIHNIDQQGLLTSDLKQDILTQTKLQRVEDLYRPYKQKKKTRATEAKRK
GLEDLADWFSQSKLDTKIEDKAQLFLNDEVTTIEDAIEGAKDIIAERISDNPQYRSKILK
DVFNQGLIVSSKKKKAEDEKQTFSMYYDYKEPIKRIANHRVLAMNRGEKEKVLSIKIDFD
TTRIQREIANVEIKTQNEATPFIKEAIQDSLKRLILPSIEREIRGDLTQNAESHAIDVFS
ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVVNPFGTFIAKGVIYPHPPISKVEAAEKE
LVKMISDYNIELLAIGNGTASRETEQFVAQVIKKYQLQAQFIIVNEAGASVYSASEIARQ
EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKDLSSALTFVVETAV
NQVGVDVNTASKSLLQYVSGLTSTIAQNIIDYKEENGPIKHHKEISRIKRLGAKTFEQSI
GFLRIVDGEEPLDNTAIHPESYDVAYRMLHQLDLTAQDIGSVKLKNTLSNVNISTLVSQL
NIGEPTLKDIIQSLIAPNRDPRDEFETPILKSDVLSIEDLSKGMKLNGTVRNVVDFGAFV
DIGVKQDGLVHISKLSKKFVKNPMDMISVGDIVEVWILDIDENKGKVSLTMVAPNE
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggataacagtttaattgaaacaattgtaagtaaatatcaattttcggaaaaacaaatt
aaagcagttttaaaattgctgaaagaaaacaatacggttccatttatagcaagatatcgt
aaagaagctacaggtggacttgatgaagtagaaattaaacaaatcaatgatgaatataac
tatatgttaaatcttcaaaaacgtaaagaagaagtaatacataatattgatcaacagggt
ctattaacttctgatttaaagcaagacatattaacacagacgaagctacaaagagttgaa
gatttatatcgtccatataaacaaaaaaagaaaacacgtgcaactgaggctaaaagaaaa
ggattagaagatttagcagattggttttcacaatcaaaattggatacaaaaattgaagat
aaagctcaattattcttaaatgatgaagtgactacaattgaagatgcgatagaaggggct
aaagatattatagctgaacgtatttcggataatcctcaatatcgctctaaaatacttaaa
gatgtttttaatcagggactaattgtttcctcgaaaaagaaaaaagccgaagatgagaaa
caaacattttctatgtactatgattacaaggaaccaattaaacgtattgctaatcatcgt
gttttagcgatgaatcgaggagaaaaagaaaaagtattatcaataaaaattgattttgac
acgacacgtattcaaagagaaatagcaaatgttgagataaaaactcaaaatgaagcaact
ccgtttattaaagaggctattcaggatagccttaagcgattaattcttccttcaatagaa
agagaaattagaggagatttaacacaaaatgcagaatctcatgcaatagatgtattcagt
gaaaatcttagaaatttattactacaaccaccaatgaaaggtaaacaaattcttggagta
gatccagcatttagaacagggtgcaaacttgctgtcgtcaatccatttggtacctttatt
gctaaaggtgttatttatcctcatcctccaatatcaaaagttgaggcagccgaaaaagag
ctggtaaagatgataagtgactataatattgagcttttagcgattggtaacggtactgcg
agtagagaaactgaacaatttgttgctcaagtaataaaaaaatatcaacttcaagctcaa
tttatcatagtcaatgaagctggcgcatcagtttattcagcatcagaaattgctagacaa
gaatttccagattttcaagtagaagaacgaagtgcagtttcaattggtagaagagttcag
gatcctttaagcgaacttgttaaaatagatcctaaatctataggagtaggacagtaccaa
catgatgtcaaccaaaaagatttaagtagtgccttaacgtttgtagtagagactgccgtc
aatcaagttggtgtggatgtgaatactgcttctaaatccttgttacaatatgtatcaggt
cttacatcaactatcgctcaaaatattattgattataaggaagaaaacggacctataaaa
catcataaagaaataagtagaattaaacgattaggtgcaaaaacatttgagcaaagtatt
ggttttttaagaattgttgatggtgaagaacctttagataatactgcaatacaccctgaa
agttacgatgttgcatatcgcatgcttcatcaattagatttaactgcacaagatataggt
tccgttaaactcaaaaacacgttatcaaatgttaatatttcaacacttgtatctcaatta
aatattggtgaacctacattaaaagatataatacaatcattgattgcacctaatagagat
ccaagagatgaatttgaaacacctattttgaagtccgatgtattatcgattgaagattta
tctaaaggcatgaagttgaatggtacagtaagaaatgttgttgactttggagcatttgta
gatatcggtgttaaacaagacggactagtacacatatcaaaattatctaagaaattcgtt
aaaaatccaatggatatgataagtgtaggagatattgtagaagtttggattttagatata
gatgaaaataaaggcaaagtttcattgactatggttgccccaaatgaataa

DBGET integrated database retrieval system