KEGG   Staphylococcus epidermidis ATCC 12228: SE1745Help
Entry
SE1745            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD RmlD_sub_bind DapB_N Semialdhyde_dh adh_short TrkA_N Shikimate_DH Trp_syntA
Motif
Other DBs
NCBI-GeneID: 1057050
NCBI-ProteinID: NP_765300
UniProt: A0A0H2VHI5
Position
complement(1795994..1796650)
Genome map
AA seq 218 aa AA seqDB search
MSILVIGANGGVGSKLVSQLNEEHVDFTAGVRKEDQVKELENKGIKATLIDVEKNSINDL
KNIFTDYDKVIFSVGSGGSTGADKTIIVDLDGAVKTIKASKEAGIKHYVMVSTYDSRREA
FDASGDLKPYTIAKHYADDYLRTSDLNYTIVHPGSLTDDAGTGKIEADLYFDKAGSIPRE
DVATVLKEVVTSDGFNNQEFQILSGNHGVKDALKNYES
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttagttattggagcaaatggaggcgtaggttctaaactagtaagtcaatta
aatgaagaacacgttgattttacagctggtgtacgtaaggaagatcaagttaaagaatta
gaaaataaagggattaaagctacattaatagatgtagaaaaaaatagtattaatgattta
aaaaatatctttacagattatgataaagttatcttttcagttggatctggtggaagcact
ggagcggataaaacaatcattgttgatttagatggtgctgtaaaaacaattaaagctagt
aaagaagcgggtatcaaacattatgttatggtatcaacatacgattctagacgtgaagca
ttcgatgcgagtggagatttaaaaccgtatacaattgcaaagcattatgctgatgattac
ttaagaacatcagatcttaattatacaattgtacatccaggttcacttacagatgatgct
ggaactggaaaaatagaagctgatttatatttcgacaaagcaggatcaattccacgtgaa
gatgttgctacagttttaaaagaagtagtaacttctgatggttttaataatcaagaattc
caaattttaagtggcaatcatggtgttaaagatgcattgaaaaactatgaatcttaa

DBGET integrated database retrieval system