KEGG   Staphylococcus epidermidis ATCC 12228: SE1746Help
Entry
SE1746            CDS       T00110                                 

Definition
repressor protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1796774..1797136
Genome map
AA seq 120 aa AA seqDB search
MLECEFSMSGYHINVESNQDTLIKVTHIFKALSDFNRVRIMEFLENGEASVGHISHSLNM
TQSNVSHQLKLLKSTHLVKSKRQGQSMIYSIDDIHVSTLLKQAIHHAKHPSEGGISNDKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgttggagtgtgaattttcaatgagtggatatcatattaacgttgaaagcaatcaggat
acattgattaaagtcactcatattttcaaagctttaagtgattttaatcgtgtgagaata
atggagtttcttgaaaacggtgaagcaagtgttggacatatttcacattctttaaatatg
actcaatcaaatgtatcacatcaattgaaactacttaaaagcactcatcttgttaaatct
aaaagacaagggcaatcaatgatttattctatagatgatatacacgtttcaactttactt
aaacaagccattcaccacgccaaacatcctagtgaaggtggaatttctaatgacaaatca
taa

DBGET integrated database retrieval system