KEGG   Staphylococcus epidermidis ATCC 12228: SE1793Help
Entry
SE1793            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K16785  
energy-coupling factor transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Energy-coupling factor transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE1793
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter [MD:M00582] [OT]
    Shared module
     SE1793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1850681..1851487)
Genome map
AA seq 268 aa AA seqDB search
MKNKLIIGRYLPMQSIIHQLDPRAKLIFVFFFILLIFFCHSLGTYAWLFLFIILFIKLAR
IPFWFLIKGLTLIFFFLVFTFSMHVLFTNGGIVLFQWKFITIESNGVMEGIYISLRLIFI
VMIATIMTLSTSPIDLTDAFEKLFAPLKVIKVPVHQLSMMMSIALRFIPTLMDELEKIIL
AQKSRGSEISSGSLITRIRAFIPIMIPLFISAFQRAEELAIAMEVRGYDINIKRTSYRLL
HWQYKDTLTVLLLIPIATILFILKFSGV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaattaatcattggacgatatcttcctatgcaatcaattattcatcagctt
gatcctagagctaagttaatatttgtctttttctttattcttttaatttttttctgtcat
tcactaggtacatatgcatggctgtttctttttataatattatttattaagttagcacgt
attcctttttggtttttaattaaaggattaacacttatcttcttcttcttggttttcact
ttttctatgcatgtgttatttactaatggaggtatcgtattatttcaatggaagtttatc
actattgaatcaaatggtgttatggaaggaatttatatatcactaagattgatttttata
gttatgattgcaacaatcatgacactttcgactagtccgattgatttaacagatgctttt
gaaaaattatttgcacctcttaaagtgattaaagtaccagtgcatcaattaagtatgatg
atgtctattgctctaaggtttataccaacgttaatggacgaattagaaaaaattatactt
gctcaaaaatctagaggatcagaaataagttcaggaagtttaataacacgaattagagct
tttatacccatcatgattccattatttatttcagcctttcaaagagcagaagaactagct
atagcaatggaagtcagaggttatgatattaacatcaaacgaacaagctataggttatta
cattggcaatataaagacacattaacagtcttacttttaatacctatcgctactatatta
tttattttaaaattttcaggagtgtaa

DBGET integrated database retrieval system