KEGG   Staphylococcus epidermidis ATCC 12228: SE1830Help
Entry
SE1830            CDS       T00110                                 

Definition
3-oxoacyl-ACP reductase
Orthology
K00034  
glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pentose phosphate pathway
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE1830
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SE1830
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     SE1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1872965..1873756
Genome map
AA seq 263 aa AA seqDB search
MFEELENKVVLITGAATEIGKSIAENFGKAKAKVVINYRSDRHHDEIEEIKQTVAKFGGQ
TLVVQGDVSIEEDIKRMIETTINHFGTLDIIINNAGFENSIPTHEMSIDDWQKVIDINLT
GAFVGSREAINQFLKENKKGTIINISSVHDTIPWPNYVHYAASKGGLKLMMETMSMEYAQ
YGIRINNISPGAIVTEHTEEKFSDPTTREETIKMIPAREIGNAQDVANAVLFLSSDLASY
IHGTTLYVDGGMMNYPAFMGGKG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaagaattagaaaataaagtggttcttattactggagctgccactgaaattggc
aaatctattgcggaaaattttggtaaagctaaggccaaggttgttataaattaccgttct
gatcgacatcatgatgaaattgaggaaattaaacaaactgttgctaaatttggtggtcaa
acattggtggttcaaggtgatgtttcaattgaagaagatattaaacgaatgattgaaaca
acaattaatcactttggaactttagacattataattaataatgctggattcgaaaattca
atcccaactcatgaaatgtcgattgacgactggcaaaaagttattgacataaacttaact
ggcgcctttgtgggttcaagagaagccatcaatcaatttttaaaggaaaacaagaaaggt
actattattaacatttcgagtgttcatgacactattccatggcctaattatgtacactat
gccgcaagtaaaggtggcttaaaattaatgatggaaacaatgtcaatggaatatgcccaa
tacggtattcgtattaataatatatctcctggggcaattgttactgaacacactgaagaa
aaattttctgacccaacgacgcgtgaagaaacaataaaaatgatacctgcacgtgaaatt
ggaaatgctcaagatgtagctaatgcagtactattcctatcttcagatcttgcaagttat
atacacggtacaacattgtacgttgatggtggcatgatgaactatccagcatttatgggt
ggtaaaggttaa

DBGET integrated database retrieval system