KEGG   Staphylococcus epidermidis ATCC 12228: SE1830Help
Entry
SE1830            CDS       T00110                                 

Definition
3-oxoacyl-ACP reductase
Orthology
K00034  
glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pentose phosphate pathway
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sep01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sep00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1872965..1873756
Genome map
AA seq 263 aa AA seqDB search
MFEELENKVVLITGAATEIGKSIAENFGKAKAKVVINYRSDRHHDEIEEIKQTVAKFGGQ
TLVVQGDVSIEEDIKRMIETTINHFGTLDIIINNAGFENSIPTHEMSIDDWQKVIDINLT
GAFVGSREAINQFLKENKKGTIINISSVHDTIPWPNYVHYAASKGGLKLMMETMSMEYAQ
YGIRINNISPGAIVTEHTEEKFSDPTTREETIKMIPAREIGNAQDVANAVLFLSSDLASY
IHGTTLYVDGGMMNYPAFMGGKG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaagaattagaaaataaagtggttcttattactggagctgccactgaaattggc
aaatctattgcggaaaattttggtaaagctaaggccaaggttgttataaattaccgttct
gatcgacatcatgatgaaattgaggaaattaaacaaactgttgctaaatttggtggtcaa
acattggtggttcaaggtgatgtttcaattgaagaagatattaaacgaatgattgaaaca
acaattaatcactttggaactttagacattataattaataatgctggattcgaaaattca
atcccaactcatgaaatgtcgattgacgactggcaaaaagttattgacataaacttaact
ggcgcctttgtgggttcaagagaagccatcaatcaatttttaaaggaaaacaagaaaggt
actattattaacatttcgagtgttcatgacactattccatggcctaattatgtacactat
gccgcaagtaaaggtggcttaaaattaatgatggaaacaatgtcaatggaatatgcccaa
tacggtattcgtattaataatatatctcctggggcaattgttactgaacacactgaagaa
aaattttctgacccaacgacgcgtgaagaaacaataaaaatgatacctgcacgtgaaatt
ggaaatgctcaagatgtagctaatgcagtactattcctatcttcagatcttgcaagttat
atacacggtacaacattgtacgttgatggtggcatgatgaactatccagcatttatgggt
ggtaaaggttaa

DBGET integrated database retrieval system