KEGG   Staphylococcus epidermidis ATCC 12228: SE1868Help
Entry
SE1868            CDS       T00110                                 

Definition
(RefSeq) sarR protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 Rrf2 MarR DUF4303 UDG
Motif
Other DBs
NCBI-GeneID: 1055737
NCBI-ProteinID: NP_765423
UniProt: A0A0H2VJ10
Position
complement(1905005..1905349)
Genome map
AA seq 114 aa AA seqDB search
MGKIKDINDLVNATFQVKKFFRDTKKQYNLNYEEIYILNHILKSESNEISSKEIATCSEF
KPYYLTKALQKLKDLNLLSKKRSVHDERTVIVFVSDEQREKIKKLILELENYIK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaattaaagacatcaatgatttggttaatgcgacatttcaagtaaaaaaattt
tttagagatactaaaaagcaatataatttaaattatgaagaaatttatattcttaatcac
attttgaaaagtgagtctaacgaaatatcttcaaaagaaattgctacatgttcagagttt
aaaccgtattatttaactaaagcattacaaaaattaaaagatttaaatttactatctaaa
aagagaagcgtgcatgatgaaagaacagtaattgtatttgtatcagatgaacaacgagaa
aaaataaaaaaattgattttagaattagaaaactatatcaaataa

DBGET integrated database retrieval system